KEGG   Gekko japonicus: 107121382Help
Entry
107121382         CDS       T04299                                 

Definition
(RefSeq) cationic trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
gja  Gekko japonicus
Pathway
gja04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107121382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gja01002]
    107121382
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107121382
Enzymes [BR:gja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107121382
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107121382
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107121382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 107121382
NCBI-ProteinID: XP_015279782
LinkDB All DBs
Position
Un
AA seq 249 aa AA seqDB search
MKFLLLLACLGAAAAFPFGDDDDDKIVGGYTCPEHSLPYQVSLNAGYHFCGGSLIDNQWV
LSAAHCYQSGRIQVRLGEYNIDVLEGSEEFIEAEKQIRHPGYSPRNMDNDIMLIKLATPA
TLNSRIRAISLPSRCVTAGTECLISGWGNTLSNGCNLPELLQCLDAPVLTDAECKDALPG
KITTNMMCVGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGVGCALSGYPGVYTKVCNYVD
WIQETIAAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccttctgctccttgcctgcctgggtgcagctgctgcttttccctttggtgac
gatgacgacgacaagatcgtagggggttacacctgcccggagcactctctcccttaccag
gtgtctctgaatgcggggtaccacttttgcgggggctccctcatcgacaatcagtgggtc
ctttcagcagcccactgttaccaatctggccgcatacaggtaagactcggggagtacaac
atagatgtgctggaaggctcagaagagttcatcgaggccgagaaacaaattcgccaccct
ggctacagcccaaggaacatggacaacgatattatgctcatcaagctggccacccccgcc
accttgaactcccgcatccgggccatttccttgccttcccggtgtgtaacagctgggacc
gagtgcctcatctcggggtgggggaacaccctcagcaatggatgcaacttgcccgagctc
ctccagtgcctggatgctcccgtcttaactgatgcagagtgcaaggatgcccttcccggg
aaaatcaccactaacatgatgtgtgtggggtacttggagggcggcaaagattcctgccag
ggtgactctggtggacctgtggtgtgcaacggggagctccaaggcgttgtgtcctggggg
gtagggtgtgccctgagtggctacccaggggtatacaccaaggtctgtaactacgttgac
tggatccaggagacaattgcagccaactaa

DBGET integrated database retrieval system