KEGG   Gekko japonicus: 107121511
Entry
107121511         CDS       T04299                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
gja  Gekko japonicus
Pathway
gja04068  FoxO signaling pathway
gja04110  Cell cycle
gja04115  p53 signaling pathway
gja04218  Cellular senescence
gja04310  Wnt signaling pathway
gja04340  Hedgehog signaling pathway
gja04371  Apelin signaling pathway
gja04510  Focal adhesion
gja04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107121511 (CCND1)
   04340 Hedgehog signaling pathway
    107121511 (CCND1)
   04371 Apelin signaling pathway
    107121511 (CCND1)
   04068 FoxO signaling pathway
    107121511 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107121511 (CCND1)
   04115 p53 signaling pathway
    107121511 (CCND1)
   04218 Cellular senescence
    107121511 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107121511 (CCND1)
   04530 Tight junction
    107121511 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107121511
NCBI-ProteinID: XP_015279910
LinkDB
Position
Un
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLINDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRYLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPNELLQMELLLVNKLKWNLAAMTPHDFIEHFLAKMPVAEDSKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSKVIRCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctctgctgtgaagtggagaccatcaggagagcctacctagatgcc
aaccttatcaatgacagggtcttgcagactatgctgaaagcagaagagacctgctcgccc
tcggtctcctacttcaagtgcgtacagaaggagatcttaccatatatgaggaaaatagtg
gccacttggatgttggaggtttgtgaggaacagaaatgcgaagaggaggttttccctttg
gctatgaattatttggacagatatctctcctttgaacccctcaagaaaagccgtttgcaa
cttctaggagctacctgtatgtttgtggcttcaaaaatgaaggagactattcctctaact
gcagaaaaattgtgcatttacactgacaactccattagacccaacgaattactgcaaatg
gaattgcttctggtgaataagctgaaatggaatctggcggcaatgacccctcatgatttt
attgaacattttctagctaaaatgcctgtggcagaggacagcaagcagatcatacgtaaa
cacgcccagacttttgtggctctatgcgctacagacgttaagtttatttcaaatccacct
tccatgattgctgctggtagcgtggtagcagctgtgcaaggccttcaccttggaaacact
aatactttcctctcttatcaatgtctcacacatttcctatcaaaagttatcagatgtgat
ccggattgtttacgagcgtgccaggaacagattgaatccctccttgaatctagtctacgc
caggcgcagcagcacaatgtatcttcagaaacaaagactgttgaagatgaagcagacctt
tcctgcacacccactgatgttagagatgtgaatatttaa

DBGET integrated database retrieval system