KEGG   Gekko japonicus: 107121970Help
Entry
107121970         CDS       T04299                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
gja  Gekko japonicus
Pathway
gja00590  Arachidonic acid metabolism
gja01100  Metabolic pathways
gja04370  VEGF signaling pathway
gja04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107121970 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107121970 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107121970 (PTGS2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107121970 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 107121970
NCBI-ProteinID: XP_015280477
LinkDB All DBs
Position
Un
AA seq 602 aa AA seqDB search
MKVSCVVLLSLLAVSQAANPCCSNPCQNRGVCMTTGFDQYECDCTRTGYYGENCTKPEFW
TWLRVSLKPTPTTVHYILTHFRGVWDIINSLPFLRDAIMRYVLMSRSHLIESPPTYNSHY
AYKSWEAYSNLSYYTRTLPPVAHDCPTPMGVKGKKELPDSQIIVDKFLLRRKFIPDPQGT
NIMFTFFAQHFTHQYFKTDHHKGPAFTKALGHGVDLSHIYGETLDRQLKLRLLKDGKLKY
QVIGGEMYPPTVKETQAEMIYPPNVPEHLQFSVGQEVFGLVPGLMMYATLWLREHNRVCD
VLKKEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFQIQDQEYTYQQFLYNNSIMLEHGLSQMVTSFSKQRAGRV
AGGRNVPAAVQKVAKASIDQSRQMRYQSLNEYRKHFLLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPALLVEKPRPGAIFGETMIELGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFDIVNTASLRNLICNNVKGCPFTAFHVINSETAATTNFSTASAGIEDINPAVVLKEQYA
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgtcctgcgttgtccttttgtctctcctggctgtcagtcaagcagctaatcct
tgctgttcaaatccatgccagaacagaggagtgtgcatgacaacaggatttgaccaatat
gaatgtgactgtacccggacaggatactacggggaaaactgtactaaaccggaattttgg
acttggctgagagtgtcgctgaaacccactccaacaactgtccattacatcctcactcac
ttcagaggagtctgggatatcatcaacagcctcccctttcttcgtgatgccatcatgaga
tatgtgctgatgtcaaggtcccatttaattgagagcccaccaacatataatagccattat
gcctacaaaagctgggaagcgtattcgaatctctcctactatactcgaactctccctcca
gtagcccatgactgcccaacacctatgggtgtaaaaggaaagaaggaacttccagattca
cagatcattgtcgataagtttctgctgaggagaaaatttattcccgaccctcaaggcaca
aacattatgttcacgttctttgcccagcatttcacccaccagtatttcaagacggatcac
cacaaggggccggccttcacaaaagcccttggccatggggttgacctgagtcacatctat
ggagagactttggacagacagctgaaactgagactgctcaaggatggaaagctgaaatat
caggtgatcggtggagagatgtacccacctactgtgaaagaaacccaggcagagatgata
tatccacccaacgtccctgagcacctgcagttttctgtaggacaggaggtctttggtttg
gttccaggactgatgatgtatgctaccttatggctccgggaacacaaccgggtctgtgat
gtacttaaaaaggagcatccagaatgggacgatgagcagctgttccaaactaccaggctg
atcctgataggagagaccatcaagattgtgattgaagactatgtgcagcacttaagtgga
taccacttcaagctgaagtttgacccagagctgctcttcaaccagcgattccagtatcaa
aacagaatagccgctgagttcaacaccctttaccactggcatccccttctgcctgacacc
tttcaaatccaggaccaagagtatacctaccaacagtttctctataacaactccatcatg
ttggagcatggcctttcccaaatggtgacctccttctccaagcaaagggctggaagggta
gctgggggtaggaatgttcctgctgctgtacagaaagttgctaaagcctccattgatcaa
agcaggcagatgagataccagtccttgaatgagtaccggaagcactttctgttgaaacct
tttaagtcattcgaagaacttacaggagaaaaagaaatggctgcagaacttgaagagctt
tatggagacattgatgcgatggagctgtacccagcacttcttgttgaaaagccacgccca
ggtgccatctttggtgagaccatgatagaacttggggcaccattttccttgaaaggcctc
atgggtaatgccatctgctcgcctgaatactggaagccaagtactttcgggggcaaagtt
ggctttgacatagttaacacagcctccctccgaaatctcatctgcaacaatgtgaagggc
tgccctttcactgcctttcatgtcataaactcggaaacagcggcaacaactaacttcagc
actgccagtgctggaatagaagatatcaaccctgctgtggtattgaaagaacagtatgct
gagctatag

DBGET integrated database retrieval system