KEGG   Gekko japonicus: 107123147Help
Entry
107123147         CDS       T04299                                 

Gene name
HADH
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase
  KO
K00022  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
gja  Gekko japonicus
Pathway
gja00062  Fatty acid elongation
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00380  Tryptophan metabolism
gja00650  Butanoate metabolism
gja01100  Metabolic pathways
gja01212  Fatty acid metabolism
Module
gja_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gja_M00085  Fatty acid elongation in mitochondria
gja_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107123147 (HADH)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107123147 (HADH)
   00071 Fatty acid degradation
    107123147 (HADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107123147 (HADH)
   00310 Lysine degradation
    107123147 (HADH)
   00380 Tryptophan metabolism
    107123147 (HADH)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     107123147 (HADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N 3HCDH Pyr_redox_2 Pyr_redox NAD_binding_2 UDPG_MGDP_dh_N NAD_Gly3P_dh_N F420_oxidored AlaDh_PNT_C 2-Hacid_dh_C DAO NAD_binding_7 FAD_binding_2 GIDA Herpes_ori_bp FAD_binding_3 HI0933_like NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 107123147
NCBI-ProteinID: XP_015281824
LinkDB All DBs
Position
Un
AA seq 309 aa AA seqDB search
MAFATRQFLRAISTAAAKKLVVKHVTVIGGGLMGAGIAQIAAATGHTVILVDQTDEILNK
SKKGIQESLKKLAKKKFADKPEEGTQYIEKVLKNLTTSTDPVSVVHSTDLVVEAIVENVA
VKNELFKTLDKFAPEHTIFASNTSSLPITEMANATTRQDRFGGLHFFNPVPLMKLVEVVK
APMTSQKTFESLVDFTRALGKTPVSCKDTPGFVVNRLLVPYLMEAVRLFERGDASKEDID
VAMKLGAGYPMGPFELLDYVGLDTSKYIIDGWHQLEPENPLFAPSPLLDKLVEEKKLGKK
TGEGFYNYQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgccacccgccaattcctgcgcgcgatttccaccgcggccgccaaaaagctg
gtggtgaagcatgtgacggtgatcgggggcggcctgatgggcgccgggattgcccagatt
gctgcagcaactggccacactgtgatactggtggaccaaacagatgaaatattaaataaa
tccaagaaaggaattcaggagagtctgaaaaagctggcaaagaagaagtttgcagacaaa
cccgaggaaggcactcagtacattgagaaggtcttaaagaacctgacgacaagcacagat
ccagtctctgtcgtacacagcaccgaccttgttgtggaggccattgtggaaaacgtagcc
gtgaaaaatgagcttttcaagacgctggataagtttgcacctgaacacacgatatttgct
agtaacacttcatccttgcccattacagagatggccaacgctactactaggcaggaccgt
tttgggggcctacacttcttcaatcccgtgcctttgatgaagcttgttgaggttgtcaag
gcaccaatgaccagccagaagactttcgaatctctcgtggattttacgagagcactgggg
aaaacccctgtgtcttgcaaggacactcctggttttgttgtcaatagactccttgtgcct
tacctgatggaagctgttcggctttttgagagaggagatgcgtcaaaggaagatattgat
gttgccatgaagctgggagcaggctaccccatgggcccatttgaacttttggactatgtt
ggcttggataccagtaaatatattatagatgggtggcatcagttggagcctgaaaaccct
ctctttgctccaagtccgctgctggataaactagtagaagagaagaaattggggaagaaa
actggagaaggattttacaactaccaatga

DBGET integrated database retrieval system