KEGG   Gekko japonicus: 107123326Help
Entry
107123326         CDS       T04299                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
gja  Gekko japonicus
Pathway
gja00240  Pyrimidine metabolism
gja00983  Drug metabolism - other enzymes
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    107123326 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107123326 (TK1)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     107123326 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK ATPase_2 AAA_14
Motif
Other DBs
NCBI-GeneID: 107123326
NCBI-ProteinID: XP_015282052
LinkDB All DBs
Position
Un
AA seq 234 aa AA seqDB search
MSCLMMPGVQPGSPCKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYKCLLIKYAKDTR
YSASGVSTHDRNTMEALSACYLKDVHQEALNSAVIGIDEGQFFPDIVEFCEAMANAGKTV
IIAALDGTFQRRAFGNILQLVPLAESVVKLNAVCMECYREASYTKRLGTEKEVEVIGGAD
KYHSVCRVCYFKKRSHQPVPENKENLPGGSKASEISAARKVLAACQIKQWSPSK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcttgatgatgcccggagtgcaaccagggtctccctgcaaggcccgcggtcag
atacaggttatctttggacccatgttctctgggaaaagcactgaactcatgcgccgggtc
cgtcgttttcaaattgcacagtacaaatgtctgctgatcaagtatgccaaggatacacgc
tactctgccagtggggtctccacacatgacaggaataccatggaggccctgtcagcttgt
tacctcaaagatgtgcatcaagaggccctcaactctgcagtgattggcatcgatgagggc
cagttttttcccgatattgtagagttctgtgaggcaatggccaatgcagggaagacagtc
atcattgcagccctggatgggaccttccagaggagggcctttgggaacatcttgcagctg
gtccccttggcagagagtgtggtgaaactgaatgcggtctgtatggagtgttatcgtgaa
gcctcttacacaaagaggctgggaacagaaaaagaggtggaagtgattggaggagcagat
aagtatcattcagtctgccgtgtctgttacttcaagaagcgatcacaccagccagtgcct
gagaacaaagagaacctaccaggaggaagcaaagcatcggagatctctgcagccaggaag
gtcttagctgcctgtcagatcaagcagtggagcccatcaaagtga

DBGET integrated database retrieval system