KEGG   Gekko japonicus: 107123582Help
Entry
107123582         CDS       T04299                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
gja  Gekko japonicus
Pathway
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00640  Propanoate metabolism
gja00650  Butanoate metabolism
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja01212  Fatty acid metabolism
gja03320  PPAR signaling pathway
gja04146  Peroxisome
Module
gja_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gja_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107123582 (EHHADH)
   00650 Butanoate metabolism
    107123582 (EHHADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107123582 (EHHADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107123582 (EHHADH)
   00310 Lysine degradation
    107123582 (EHHADH)
   00380 Tryptophan metabolism
    107123582 (EHHADH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107123582 (EHHADH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107123582 (EHHADH)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107123582 (EHHADH)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     107123582 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107123582 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     107123582 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 TrkA_N NAD_binding_2 ApbA
Motif
Other DBs
NCBI-GeneID: 107123582
NCBI-ProteinID: XP_015282320
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAQYAKGAAAVAVIRICNPPLNTLSVKTLLTLQQEVKHANIDPTVKAVVICGANGKFSAG
ADIKLFSNPDWGSAPSLGSLVDLIEKSDKPMVAAIEGLALGGGLEVALGCHYRIAHVQAR
VGLPEVTVGLLPGAGGTQRLPRLTGVPAALDIITTGKHIWAAEALKLGIIDEIVKGNTIE
AAIRLAERVSDQPVETRRLCSKQIPKLPNMEAIIEEALVKVKKQARGCLAPEMCFQAVQA
SLCLPFEEGIRKERELFLFLLSSGQAKALQYAFFAQRAMEKWTLPSGASWKTAAPQPIQR
AAVIGLGTMGRGIVASLVKAKVPVVALEQDKNHLELGRRAITALLDREGLRMQQNSQALD
VHKPGLLHFTLDFSALKDVDLVIEAVFEDMVLKKEIFHKLSIVCKPEAFLCTNTSCLDID
EIAAVTSRPHQVIGTHFFSPAHVMKLLEVIHGRHTSPTAIATVMSLGKAMGKIGVVVGNC
FGFVGNRLLLPYNEQTYFLIEEGSTPEEVDKALVGFGFKMGPFQVSDLAGLDVGWRIRKG
QGLTEASLPLGTPPRQRNGRRYSPLPDFLCEKGRYGQKTGKGWYQYDKPGGRVPRSDPWL
HSFLSDYRNTHNITVRTVTQDEILERCLYSLVNEGFRILSDGIASCPEAIDTIYINGYGW
PRHRGGPMFYASEVGLSTVLAKLQKYAERNPDIPSLQPSPLLQKLVALGSPPVSEWSSLV
GSQNSKL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtacgcgaagggggcagctgcggtggccgtgatccgaatctgtaatcctcca
ctcaacacgctcagtgttaaaacattactgactttgcagcaagaagtgaagcatgcaaat
attgatcccaccgtgaaagctgttgtgatttgtggtgcaaatggcaaattcagtgcaggt
gctgatatcaaactgttttccaaccctgattggggaagtgcgcccagtctggggtcatta
gttgatttaatagagaagagtgacaaaccaatggtggctgcgattgaaggtctggcattg
ggaggaggcttggaagtggcattgggctgtcattacaggattgcacatgtgcaggcacgg
gtaggtttgcctgaggtgacagtgggcttacttcctggtgctggtgggactcaacggctt
cccagattgactggagtgccagctgcacttgatatcatcacaacaggaaagcacatatgg
gctgctgaagcactgaaactgggaatcatcgatgaaatcgtaaaaggcaatacaattgaa
gcagcaatacgtttagcagaaagagtgtctgatcagccagtggaaactcgtaggctctgc
tcaaagcaaattcccaaactacccaatatggaagccatcattgaagaggcactggtgaaa
gtgaagaagcaggcccgtgggtgtcttgcaccagaaatgtgcttccaagctgtacaagcc
tccttgtgtttgccctttgaggagggaattcgcaaagagagagaactctttctcttcctg
ctgtcttcaggccaggctaaggcattgcagtatgccttctttgcacaaagagccatggag
aagtggacattgcccagtggagcatcctggaaaactgctgcccctcagccaatccagagg
gcagctgtgatagggttgggaacaatgggccgaggcatcgtggcctctctggtgaaggcg
aaggttccagttgtggctttggaacaggataagaatcacttagagctaggaagaagagct
ataacggccctcttagaccgtgaaggtttgagaatgcaacagaacagccaagcattggat
gtccataagccgggtctgcttcacttcacactggattttagtgccctgaaagatgtagat
ctcgttattgaggctgtttttgaagacatggtgctgaagaaagagatcttccacaagtta
tctatagtctgcaaacctgaggcctttttgtgtactaatacttcttgtctagatattgat
gagattgctgctgtcactagccgtccacaccaggtcattggtacccattttttctcacca
gctcatgtaatgaaattgttggaggtaatccatggtcggcatacatcccccactgccatt
gccactgttatgagcttaggcaaagctatggggaaaattggggttgtagtagggaattgt
tttggctttgtcgggaaccgattgttgcttccttataatgagcaaacatatttcctcata
gaagagggcagtacacctgaagaagtagacaaagctctagtgggatttggtttcaaaatg
gggcccttccaagtatcagatctcgctgggcttgacgttggatggagaataaggaaagga
caaggcctgactgaagccagcctgcctcttggcacacctcctcgccagcgaaatggaaga
cgatacagcccactccctgacttcttatgcgagaaagggagatatggacagaaaacaggc
aagggatggtatcaatacgataaaccaggtggtagggtccccaggtcagatccttggctt
catagttttctttctgactataggaatacccataatattacagtacgcactgttacacag
gacgaaatcttggagcgctgcctgtattcccttgtcaatgagggtttccggatattgtct
gatggaatagcttcatgcccagaagccattgataccatctatatcaatggctatggctgg
cccagacataggggtggccctatgttttatgcctctgaggttggtttatctacagttcta
gcgaaactgcagaagtatgcagaacgtaatcctgatataccctcactacagcccagtcct
cttctgcagaagcttgtagctctgggtagtcctcctgtgagtgagtggtcatcacttgtg
ggatctcagaacagtaaactgtaa

DBGET integrated database retrieval system