KEGG   Gekko japonicus: 107123964Help
Entry
107123964         CDS       T04299                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00030  Pentose phosphate pathway
gja00051  Fructose and mannose metabolism
gja00052  Galactose metabolism
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja01230  Biosynthesis of amino acids
gja03018  RNA degradation
Module
gja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107123964 (PFKP)
   00030 Pentose phosphate pathway
    107123964 (PFKP)
   00051 Fructose and mannose metabolism
    107123964 (PFKP)
   00052 Galactose metabolism
    107123964 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107123964 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107123964 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gja03019]
    107123964 (PFKP)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107123964 (PFKP)
Protein phosphatases and associated proteins [BR:gja01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107123964 (PFKP)
Messenger RNA biogenesis [BR:gja03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107123964 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107123964
NCBI-ProteinID: XP_015282813
LinkDB All DBs
Position
Un
AA seq 780 aa AA seqDB search
MPDKKFFENLSGEGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVEAKVYFIYEGYQGMVDG
GDNIAEVSWESVSSILQVGGTVIGSARCKPFRTREGRVRAACNLVKRGISNLCVIGGDGS
LTGANQFREEWSGLLEELARSGEIDDEAVKKHAYLNIVGMVGSIDNDFCGTDMTIGTDSA
LHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEQGWED
QMCSKLSENRARKKRLNIIIVAEGAIDCHNKAITSEQIKDLVVQRLGYDTRVTILGHVQR
GGTPSAFDRILASRMGVEAVLALLEATPKTPACVVSLSGNQAVRLPLMECVQMTQEVQKA
MDGRKFLEAVQLRGRSFENNLNTYKLLSNKKSAAELPKTNFNVAVLNVGAPAAGMNAAVR
SAVRIGITEGHNMFAVTDGFEGFSRGQIKEISWGDVGGWTGQGGSILGTKRTLPGKYLKK
IAEQMRANNINALLVIGGFEAYLGLLELSAARETYEEFCIPMVMVPATVSNNVPGSDFSI
GADTALNTITDTCDRIKLSASGTKRRVFIIETMGGYCGYLASMGGLAAGADVAYIFEEKF
DIRELQANVEHLTEKMKTSIQRGLVLRNENSSENYTTDFIYQLYSEEGKGVFDTRKNVLG
HMQQGGAPSPFDRNFGTKIAAKAVLWLSKKLKESHQREEGKIFTNTEDTVCLLGMRRRNL
VFQPVGQLRDETDFEHRIPREQWWLKLRPLMKILAKYKTSYDISDSGQLEHVRRPKPTEA
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgccggacaagaagttcttcgagaacctgtcgggagaagggaaagccatcggggtgctg
accagcggcggcgatgcgcaaggtatgaatgcagcagtccgtgccgtagtgcgtatgggg
atttatgttgaagcgaaagtatattttatctatgagggataccaaggcatggttgatgga
ggtgacaacattgctgaagtttcatgggaaagtgtttcaagcatcctccaagtgggtggg
acagtgattggcagcgcacgctgcaaacctttccggacccgggaaggccgtgtgagggca
gcctgcaacctggtgaagcgtggaatcagtaacctctgtgtgattggtggggacggcagc
ttaacaggtgctaatcagttccgtgaagaatggagtggactgctagaagagctggccaga
agtggcgagattgacgacgaagctgttaagaagcacgcttacctcaacattgtgggaatg
gttggctccatcgataatgatttctgtggcacagatatgaccattggcactgactcggcc
ttgcacagaatcattgaagttgtggatgccatcatgaccactgctcaaagccatcagagg
acctttgtcctggaagtgatgggaagacactgtgggtacctagctcttgttagtgcctta
gcctgtggtgcagattgggtttttattcctgaatatccacctgagcaaggatgggaagat
cagatgtgctcaaagctttctgagaatcgtgcacgaaagaaaaggttgaatattataatt
gtagcagaaggtgccattgactgccataacaaagctatcacttcagaacaaattaaggat
cttgtagtgcagcggctgggatatgatacccgtgtaactatccttggccatgttcaaaga
ggaggcactccctctgcttttgataggattttggcaagccgcatgggtgtggaggctgtc
cttgcccttctagaggctacacctaaaactcctgcctgtgttgtgtccttgtctggaaac
caagctgtccgcctgcctttaatggaatgtgtgcagatgacccaagaagtgcaaaaagcc
atggacggaagaaaatttcttgaggctgtgcagctccgtggaaggagttttgagaataac
ttgaatacttacaagctattgtctaacaagaaatcagctgcagagcttcccaagactaac
ttcaatgtagcagttttaaatgtaggtgctccggcagcggggatgaatgctgctgttcgc
tcagctgtaagaatcggtataactgaaggacataacatgtttgctgtcacggatggattc
gaaggcttttccagagggcagatcaaagaaatcagctggggcgatgttgggggttggact
ggccaaggagggtcaattctaggcaccaaacgcacgctccctggaaagtatttgaagaag
attgcagaacagatgcgtgctaataacataaatgccctcctagttattggtggatttgag
gcctacctgggactcttggaactctctgctgcccgggagacgtacgaagagttctgtatt
cccatggttatggttcctgcaactgtatccaacaatgtaccgggttctgatttcagcatt
ggtgcagacactgctttgaacactatcactgatacctgtgaccgaatcaagttgtcagca
agtgggacaaagcggcgtgtgttcatcatcgagaccatgggtggctactgcgggtacctg
gcgagcatgggaggcctggctgcaggggctgatgttgcgtacatctttgaagagaagttt
gatatccgggaactccaggccaatgtggaacatctgactgagaagatgaaaaccagtatt
cagcgtggcttggtgttgaggaatgaaaacagtagcgagaattacaccaccgatttcatt
taccagctgtattctgaggaagggaaaggagtctttgacacccgaaagaatgtcctgggt
cacatgcaacagggtggtgccccttctccctttgatcgaaactttgggacaaaaatagca
gcaaaggctgtcctgtggctttcaaagaagctgaaagaatcccatcaaagagaggaagga
aaaatatttaccaacactgaagacactgtctgcctcctgggcatgcgacggcggaatctt
gttttccagcctgtgggccagcttagggatgaaacagacttcgagcaccgcattcctagg
gaacagtggtggttgaagctccgtccactgatgaaaatcttggccaaatacaagaccagc
tacgatatttcagattcaggccagctggagcatgtgcgcagaccaaaacctacagaagcc
tga

DBGET integrated database retrieval system