KEGG   Gekko japonicus: 107124321
Entry
107124321         CDS       T04299                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
gja  Gekko japonicus
Pathway
gja04080  Neuroactive ligand-receptor interaction
gja04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107124321 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107124321 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gja04030]
    107124321 (LPAR2)
G protein-coupled receptors [BR:gja04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107124321 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107124321
NCBI-ProteinID: XP_015283247
LinkDB
Position
Un
AA seq 344 aa
MTHCYYNETVEFFYNKSGKELCHHWRAKDVLVVVLGLTVSIIVLLTNLLVITAIVINKRF
HYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAELSLKTWFIRQSLLDTSLTASVVNLL
AIAVERHQTVFTMQLHSTMSNQRVMILICCIWVTALLLGLIPSYGWHCLCDLDNCSKMAP
LYSRSYLTFWALSNLFIFLVMVVVYTHIFVYVKRKMARMSKHTSFHPRYKETMINLIKTV
IIILSAFVICWTPGQVVLLLDGLGCKSCNVLAVEKYFLLLAEINSVINAIVYSYRDNEMR
STFRRILCFPCYRPPKYSPASVKSSNTEQRILPQNGHPSMDSSL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgacccactgctattacaacgagacggtcgagttcttctacaacaaaagtgggaaggag
ctgtgccaccactggagggccaaggatgtcttggtggtagttcttggcttgacggtcagc
atcatcgtcctgctcaccaacttgctcgtcatcaccgccattgttatcaacaagcgcttc
cactaccctatctactacctactcgggaacctggctgccgccgacctctttgctggcatt
gcttatatgttcctgatgtttcacaccgggcccaggacagctgagctctctctcaagacc
tggtttatcaggcagagcctcttggacaccagcctcacggcttcggtggtcaacctcttg
gccatcgcggtggagaggcaccagactgtcttcaccatgcagctccacagcaccatgtcc
aaccagcgggtgatgattcttatctgctgcatctgggtcacagccctgctgctgggcctc
atcccctcctacggctggcactgcctgtgcgacctagacaattgttccaagatggcgccc
ctctacagccgcagctatctgaccttctgggccctctccaatctcttcatcttcctggtc
atggtggttgtctacactcacatcttcgtctatgtgaagaggaagatggcacggatgtcc
aagcacaccagcttccacccacgctacaaggagacgatgatcaacctcatcaagacggtc
atcattatccttagtgcctttgtaatctgttggacccccgggcaggtcgtgcttctgctg
gacggcctgggctgtaagagctgcaacgtgctggccgtggagaaatacttcctcttgctg
gccgaaatcaattcggtcatcaacgccatcgtctactcctaccgggacaacgagatgcgc
agcaccttccggaggattctgtgcttcccctgctaccggcccccaaagtactcaccggct
tcagtcaagtccagtaacacggagcagaggatattaccccagaacgggcatccgagtatg
gactcctcactctaa

DBGET integrated database retrieval system