KEGG   Gekko japonicus: 107124706
Entry
107124706         CDS       T04299                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
gja  Gekko japonicus
Pathway
gja00230  Purine metabolism
gja01100  Metabolic pathways
gja04020  Calcium signaling pathway
gja04114  Oocyte meiosis
gja04261  Adrenergic signaling in cardiomyocytes
gja04270  Vascular smooth muscle contraction
gja04371  Apelin signaling pathway
gja04540  Gap junction
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107124706 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107124706 (ADCY3)
   04020 Calcium signaling pathway
    107124706 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107124706 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107124706 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107124706 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    107124706 (ADCY3)
   04916 Melanogenesis
    107124706 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107124706 (ADCY3)
   04270 Vascular smooth muscle contraction
    107124706 (ADCY3)
Enzymes [BR:gja01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107124706 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 107124706
NCBI-ProteinID: XP_015283996
LinkDB
Position
Un
AA seq 1115 aa
MPRNRAFSEPEHSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGSCLCLPRFMRLMFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIIMCTVLYTSDKLPPTLAASVGLALQIL
LFVLCKYELLPDRVTRKFMPYILWILIVAQIFCYLGLSFARFHEASDTVGWQAFFVFSFF
ITLPLRLTPIVLISAISCGIHTLVLGVTIAQQQQDSINGRDLLWQILSNVSIYLCTICVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQEGLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAQRYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGDGGSRCE
YLKEKGIVTYLILVPKQPLKNGINGVKLSVSSSHGNSPQLINTKECNGSINTTCTTPDEA
EDLDTRVVNPSFPNPRRRLRLRDLAERVVDASQNEQELNKLLNEALLERETVQALKGKST
YRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEIFIDPRLVANYVTFVVGE
VLLLILTLCSLAAIFPRVFPKKLVAFSAWIDRTRWARNTWAMSAIFILTMADIVDMLSCQ
QYYSVVNVTTLELPVGTCVENPKYYSYIAVLALIATIMLVQVSHMVKLTLMLTITGAVGV
VNIYAWRHIFHKYDEQRFWEKTSSLVPSKYSMTVMVFIMMLSFYYFSRHVEKLARTLFLW
KIDVHDQKERVYEMRRWNEALVANMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASLP
NFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTIGSTYMAASGVTPD
VNTNGYNNAVKKEDLSDKERWQHLADLADFALAMKETLMNINYQSFNNFMLRIGMNKGGV
LAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLVLKEYGFRFVRRGPIYVK
GKGELLTYFMKGRDKQGSFINGSSVTLPHQVVDSS
NT seq 3348 nt   +upstreamnt  +downstreamnt
atgcctcggaatagggccttctctgagcctgaacactcagcagagtattctgcagactac
tcggtcagcttgccctctgaccctgaacatggggtaggccgaacccatgaagtgacggtg
aggagctctggctcatgcctctgtctcccacgctttatgcgcctcatgtttgcccccgag
tctctggaaaacctctaccagacctacttccggcggcagcgccatgagactttgctggtc
ttggtggtctttgctgctctttttgactgctatgtcatcatcatgtgcactgtgttgtac
acctcagacaagctgccacctaccctggcggcctcagtgggcctggctctccagatcctc
ctgtttgtcctatgcaagtatgaactgctgcctgatcgagtcacccggaagttcatgccc
tatatcctgtggatactcatagtggctcagatattctgttacctgggcctgagctttgct
cgcttccatgaggccagcgacacggttggctggcaggccttctttgtcttctcctttttc
atcaccctccccttgcgcctcacgcccattgtccttatctcggccatctcctgtggcatc
cacaccctggtgctgggggtcaccattgcacagcagcagcaggactccatcaatggaagg
gacttgctgtggcagatcttgtccaatgtttccatctacttgtgtaccatctgtgtgggc
atcatgtcatactacatggcagaccggaagcaccgcaaagccttcctggaagcccggcag
tctttggaggtcaagctcaacctggaggagcaaagccagcagcaggaaggattgatgctt
tccattttgcccaagcatgtagctgatgaaatgctgaaggacatgaagaaggatccaagc
caaaaagagatgcaacagtttaacaccatgtacatgtaccgccatgagaatgtcagtatc
ctctttgccgacattgttggtttcacacagctgtcatcctcgtgcagtgcccaggaactg
gtgaagcttctgaatgagctctttgctcgctttgataaactagcacagaggtaccaccag
ctgcgtatcaagattctgggagactgctattactgcatctgtgggctgccggactaccgc
gaggaccatgctgtctgctccatcctcatgggccttgccatggtggaagctatttcgtat
gtgcgagagaagaccaaaacagatgtggacatgcgtgtgggcgtacacagtggcactgtc
ctgggaggggtgttgggacagaagcgctggcagtatgatgtgtggtccacagatgtgacg
gtggctaacaagatggaagctggtggcatcccaggacgtgtacacatttctcagagcacc
atggactgcttgaagggagagtttgaggtggagccaggagatggtggatcacggtgtgaa
tacttgaaggagaaggggattgtaacctaccttatactagtacccaagcagccactcaag
aacgggatcaatggtgtgaagctgtctgtctcctcatcccacgggaactcgccacagctg
atcaacaccaaagaatgcaacgggagcattaacaccacttgtaccacaccagatgaagca
gaggacctggacacccgggtggttaacccttcctttcccaaccctcggagacgcctgcgg
ttgcgggacctggcagagagggtagtggatgcttcgcagaacgaacaggagctgaacaaa
ttgctcaacgaagccttgttggagagggagacggtgcaggcgctaaagggcaaatccaca
taccgcctgtctatgcgcttcattgaccctgagatggagacacgctactctgtggagaag
gagaagcagagcggggcagccttcagctgttcatgcgtcgtcctcttcttcaccgccctg
gtggaaatcttcattgacccacggttggtggcaaattatgtgacgtttgttgttggcgag
gttcttctcctcatcctgaccctttgctcgctggctgccattttccccagggttttcccc
aaaaagcttgtggctttttccgcttggattgaccggacccgatgggccaggaacacgtgg
gccatgtctgctattttcatccttaccatggcagacattgtagacatgctcagctgccag
cagtattactccgtcgtcaacgttacaacattggagctgcctgtggggacctgtgtggag
aaccccaagtactacagctacatcgcagtgttggcgctcatcgccaccattatgctagtg
caagtcagccacatggtcaagcttaccctcatgctgacgatcactggggccgtgggggtg
gtgaacatctacgcctggcggcacatctttcacaagtacgacgagcagagattctgggag
aaaacgtcctccctggttccgtccaagtactccatgacagtgatggtgtttatcatgatg
ctgagcttctattacttttcacgccatgtggagaagttggcccggactttattcttatgg
aagatcgatgtgcatgaccagaaggagcgcgtctatgagatgaggcgctggaatgaggcc
ctcgttgccaacatgctgccagagcacgtggctcgacatttccttggctccaagaaacgg
gatgaggagctgtacagccagtcttacgatgagattggtgtcatgtttgcctctctcccc
aactttgccgacttctacacggaggagagcatcaacaatggcgggatcgagtgcctgcgc
ttcctcaatgagatcatctcagattttgacgcactcctggacgagccccagttccggtgt
atcaccaagatcaaaaccattggcagcacatacatggcagcttctggggtgactccagac
gtcaacaccaatggatacaataatgctgttaagaaggaagatctttctgataaggagcgc
tggcagcacttagcagatctcgctgactttgccttagccatgaaagagacgttgatgaac
atcaactaccagtccttcaacaacttcatgctgcgcataggcatgaacaaaggaggagtg
ctggcaggagtcattggtgcccgcaaacctcactacgacatttgggggaacacagtgaat
gtggccagccggatggagtccacgggagtcatgggaaatatacaggtggtggaagagacc
cacttggtcctgaaggaatatggtttccgctttgtgcgccgagggcccatctatgtgaag
ggcaaaggagaactgctgacctacttcatgaaagggcgagacaagcaaggctctttcatc
aatggctcctccgtgactttgcctcaccaggtggtagacagctcatga

DBGET integrated database retrieval system