KEGG   Gekko japonicus: 107124941Help
Entry
107124941         CDS       T04299                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
gja  Gekko japonicus
Pathway
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja04910  Insulin signaling pathway
Module
gja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gja_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107124941
   00051 Fructose and mannose metabolism
    107124941
   00052 Galactose metabolism
    107124941
   00500 Starch and sucrose metabolism
    107124941
   00520 Amino sugar and nucleotide sugar metabolism
    107124941
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107124941
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107124941
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107124941
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107124941
Membrane trafficking [BR:gja04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107124941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107124941
NCBI-ProteinID: XP_015283918
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMARFRREMQNGLSRDFNPTAT
LKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMETEIYDTPEDIMH
GSGTRLFDHVAECLGDFMEKREIKDKKLPVGFTFSFPCRQSKLDEGYLITWTKRFRASGV
EGADVVQLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLIFEGRITPELLTKGKLETKHVSAIEKSKEGLHKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVAATLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYSRRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLINATLAEFKLT
NEQLLQVKKRMRMEIEAGLRKKSHDHAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRMVEMHNKIYAIPIEVMQGTGEELFDHIVSCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEVGLIVGTGSNACYMEEMRNIEMVEGEQGRMCVNMEWGAFGDNGCLDD
IRTIYDKAVDEYSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRS
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGEVSRRAAQLCGAGMAA
VVDKIRENRGLEHLDITVGVDGTLYKLHPHFSKVMHQTVKELAPKCDVTFLLSEDGSGKG
AALITAVGCRLRDAEHN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgctcagctgctggcctattacttcacggaattaaaggatgatcaggtcaaa
aagatcgataaatacctgtatgccatgcgactctctgatgagactctgttggatatcatg
gcccgcttcaggagggagatgcagaatgggctttccagagactttaatccaacagcgaca
ctcaagatgctgcctacatttgtgaggtctattcctgatggctcagagaaaggggatttc
attgcactggatcttggtggatcttactttcgcattctgcgagtgaaagtctctcatgag
aagaagcaaacagttcaaatggaaacggagatctatgacactccagaagatataatgcac
ggcagtggaacacggctttttgatcacgtggcggaatgtttaggagatttcatggagaaa
cgagaaatcaaggacaagaaattacctgttggcttcacgttttctttcccgtgtcggcaa
tccaagctagatgagggttacctgataacctggacaaaacgcttcagagcaagtggtgtt
gaaggtgctgatgtggtacagttgctcaacaaagcaatcaagaaacgtggggattatgat
gcagacatcatggcagtggtcaacgacaccgttggaacaatgatgacctgtgggtttgat
gaccagcgttgtgaagttggcataattatcggcactggcacaaacgcttgttacatggag
gaaatgaggcacattgatctggtggaaggtgatgaagggcggatgtgtatcaacacggaa
tggggagcctttggagatgatggaacattagaagacatcaggactgagtttgacagagag
attgaccggggttcccttaatcctgggaaacaattatttgagaagatggtcagtggcatg
tacatgggtgaacttgtccggcttatccttgtgaagatggcaaaagaaggtctaattttt
gaaggacgaatcactccagagcttttaaccaaaggaaaacttgaaaccaagcatgtttct
gccatagagaagagcaaggaaggtttgcataaagccaaagagatattgacacgtcttggg
gtcgagccctcccatgaagactgcattgctgtccaacatgtgtgcacaattgtttccttc
cgctccgcaaacctggtggctgctactctgggggccatcttgaaccagctccgggacaat
aagggagtcggccgtctccgcaccacggtgggggttgatggctcgctttacaagatgcac
ccacagtactcccggcgcctgcacaaaacagtgaggcgcttggtgcccgactcggacgtg
cggtttctgctgtctgagagcggcagtggaaagggtgctgccatggtgacggcagtcgcc
tacaggctgtctgagcagcaccggctcatcaatgccaccctggctgagttcaagctcaca
aatgaacagctgctccaggtgaagaagaggatgcggatggagatagaggctggccttcgg
aagaaatcccatgaccacgccaaagtcaaaatgctgcccacttttgtccgcagcacacca
gatgggacagagaatggagactttctggctctggatcttggaggaacaaactttagagtt
ttgcttgtaaagattcgaagtggtaaaaggagaatggtggagatgcacaataaaatatac
gcaattcccatagaggtcatgcaagggactggagaagagctgtttgatcacattgtttcc
tgcatctcggatttcctggattacatgggaataaaaggcgcacggctgcccctgggcttt
acattttctttcccttgcaagcagacaagtttagatgctggcatccttctaaattggacc
aagggctttaaggctactgactgtgaaggagaggatgttgttaatttgctacgggaagga
attaaaagaagagaggaatttgacttagatgttgtggctgtggtgaatgatacagttggg
acaatgatgacttgtgcctatgaagatccaaattgtgaagttggactcattgtgggaact
ggcagcaatgcatgttatatggaagaaatgagaaacatagagatggtagagggagagcaa
ggaaggatgtgtgtgaacatggagtggggtgcctttggggacaatggatgcctagatgac
atcaggacgatatatgacaaagctgttgatgaatactcattaaatagtggcaagcaacgg
tatgagaagatgatcagcgggatgtacttgggggaaattgtccgcaacattttgatcgac
ttcactaaaagaggattcctcttcagaggtcagatttcagaaacgctaaaaactagaagc
atttttgaaaccaagttcctttcccagattgagagtgataggttagcactgcttcaggtt
cgtacaatcctccagcaacttggtctgaacagcacctgcgacgacagtatcattgtcaag
acagtatgcggggaagtgtcgcgaagggctgcccagctgtgtggagctggaatggcagct
gtggtagacaagataagagagaaccgcggattagagcatctggacattactgtgggggta
gatgggacgctatataaacttcatccacacttttcaaaggtcatgcaccaaaccgtaaag
gagctggcgcccaaatgcgatgtgacattccttctttccgaagacggcagcggcaaaggg
gctgccctcatcaccgcagtgggatgtaggcttcgtgacgctgagcataactga

DBGET integrated database retrieval system