KEGG   Gekko japonicus: 107125145
Entry
107125145         CDS       T04299                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04060  Cytokine-cytokine receptor interaction
gja04068  FoxO signaling pathway
gja04144  Endocytosis
gja04218  Cellular senescence
gja04350  TGF-beta signaling pathway
gja04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107125145
   04350 TGF-beta signaling pathway
    107125145
   04068 FoxO signaling pathway
    107125145
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107125145
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107125145
  09143 Cell growth and death
   04218 Cellular senescence
    107125145
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107125145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107125145
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107125145
Protein kinases [BR:gja01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107125145
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH MLANA DAG1
Other DBs
NCBI-GeneID: 107125145
NCBI-ProteinID: XP_015284085
LinkDB
Position
Un
AA seq 315 aa
FNSSVEEVKDVISKVAIISLVPLLVVTVAVILIFYCYRIQRRRKLNKAWEKNVKSKKHKD
CSDVCAIMLDDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQF
ETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKRDLGKQYWLITAFHSRG
NLQEYLIKHIISWEDLWKLGGSLARGIAHLHSDHTPCGRPKTPIVHRDLKSSNILVKNDL
TCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLDNVESFKQTDVYSMA
LVLWEMTSRCNSVGG
NT seq 949 nt   +upstreamnt  +downstreamnt
aattcaactcaagtgtagaagaagtgaaagatgtgatttctaaagttgctataataagcc
ttgtcccattgcttgtggtcactgtcgctgtgattctcatcttttactgctaccgtattc
agaggaggaggaagctcaacaaggcatgggagaagaacgtgaaatccaagaagcataaag
actgtagtgatgtttgtgccatcatgttagatgacgaccgttctgacatcagttctactt
gcgccaacaacattaaccataatactgaactgttgcccattgagttggacacccttgtgg
gcaaagggaggtttgcagaagtctataaagcgaaactgaagcaaaatacgtcagaacagt
ttgaaacagtagctgtcaagatcttcccttatgaagaatatgcctcttggaagactgaga
aagacatcttctcggacataaacctgaagcacgagaacatccttcagttcttgacagcag
aggagcgcaaaagagatttaggcaaacagtactggttgatcactgctttccactcaaggg
gaaacttgcaggaatacctcataaaacacatcattagctgggaggacctctggaaactgg
gtggctctttggctcgtgggattgcccatcttcatagtgaccatacaccttgtggccgac
ccaagaccccgattgtccacagagatctaaagagttccaatatcctggtgaaaaatgatc
taacatgctgcctctgtgactttgggctatctctgaggctggaccctactctctctgtcg
atgatctggctaacagtgggcaggttggcacagcgaggtacatggctcctgaagtcctgg
aatccagaatgaacttggataatgttgaatccttcaagcagaccgacgtctattccatgg
ctttggttctctgggaaatgacctctcgttgcaatagtgttggaggtag

DBGET integrated database retrieval system