KEGG   Gekko japonicus: 107125527Help
Entry
107125527         CDS       T04299                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04210  Apoptosis
gja04625  C-type lectin receptor signaling pathway
gja04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107125527 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107125527 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107125527 (MAP3K14)
   04672 Intestinal immune network for IgA production
    107125527 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107125527 (MAP3K14)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107125527 (MAP3K14)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: STE group
  Other
   107125527 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Herpes_pp38 APH Kdo
Motif
Other DBs
NCBI-GeneID: 107125527
NCBI-ProteinID: XP_015284435
LinkDB All DBs
Position
Un
AA seq 925 aa AA seqDB search
MAVMGIACQSAPVPTAGHPKELAMAKGPQETVVEKKSSVCKVDSPEKEVLPGPWKILSDV
IAKGTAKEDSGEGSLASVSIIAQAECENSQEFSPTFSGRPFIACKRYSRSCSLDQIPNNV
ARATEGKMAPAYRRALHRGKARKNRKKKKARLTTTPAPTRKPRTPEQESCVPVPVQEDDS
HLGTFFSSSSWCLESRKDLACDLDPSDKPGGVLRPGKLPLLKDHGKLELYKLISPAQCLD
HVWKCHTQDNLARPSETLGFSYGKFSPPFRDRGDWLPALRLGPLETYLFDDLSRANVERH
LSGLSLEQSFSKCSHQSSKATSDFVEEFLVDALKGSVVLGEPRNLAGLAKTWQGCGSGSK
ETDENEGVLLIEKLKAVDYEYREEVHWSKGQGFLGMGSFGEVYQVKDKQTGFQCAAKKVR
VENFRAEELTTCTGVAHAKILPLYGAVKEGPWVTIFIELMEGGSLSHLLKQCGSLPEDRA
LDYLAQALEGLAYLHSRNVLHGDMKADNVLLSSDRSHAVLCDFGHAAHLRPDSTGKYVVT
GDYVLGTETHLAPEVVMGKCCDLKVDVWSSCCMLLHLLNGCHPWTRYFNHPLCLKIAKEP
PPLKEIPPSCHPFTVNVIQAGLQKEPQKRAGAAELRVKACAALEQVGGLKSPWGGERREP
RHPPWAPSPTFPDHPQTAGPVPETPVSLTPFARSPGPPLNPQGLLEKTQFTSSSPRKEWL
QPWDSAPLGTKRGSWRDWRDATLEQEFQQLELELVLNRLAHPVCLEEQEQILSCLSLGSP
LLPDASDKGSMKALSLSLKDTMSSGVHSWSSQPNGQSHSWNSWLHRSRPTETPPSLDGVK
IEIHLLSGEALHIREFRGAKVGQVATGISSQIPASPFSFFTKEGQPVHCDVEVPDSGIEL
QCILAPDCSSGWRWRVRRGQLEIRS
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggggatcgcctgccaaagtgctccagtcccaaccgctgggcacccgaag
gagctggccatggccaaggggcctcaggagacggtggtcgagaagaagagcagcgtctgc
aaagtcgacagtccagagaaggaggtgctgccagggccatggaagatcctgagtgacgtg
atcgccaagggaacggccaaggaagacagtggggaagggagcctggcctccgtgtccatc
atcgcccaggcagagtgtgagaacagccaagagttcagccccactttttctggaaggcct
tttattgcttgtaaacgatacagccggtcttgcagtctcgatcagatccccaacaatgtg
gcccgcgcaaccgaggggaagatggccccagcctatcggagggccctgcaccgcggcaaa
gcacggaagaaccggaagaagaaaaaggcccgcctgacgacgacccctgccccaactcgg
aagccaaggacccccgagcaggagagctgtgtgcctgtcccagtgcaggaggatgactcc
cacttgggcaccttcttcagcagcagttcatggtgtttggagtcacgcaaggatctggcc
tgcgatcttgacccttccgataaacctggcggtgtcctccgtcctggcaagctgcccttg
ctgaaggaccacggcaaactagagctgtacaagctgatcagccccgctcagtgcctggac
catgtctggaagtgccacactcaggacaatttagcccgtccatcagagaccctgggcttc
agttatggcaagttctcccctcctttccgtgaccgtggtgactggcttcctgccttgaga
cttggccctctggagacgtatctctttgacgacctttcgcgtgccaacgttgagcgtcac
ctgtcaggcctgagcttggagcagagcttctccaaatgcagccatcagtcctccaaagcc
acctcagactttgtagaggaattcctggtagatgcattgaaaggaagcgtcgttcttgga
gagccgaggaacttggctggtttggccaagacttggcagggatgtggatcgggctccaag
gagacggatgagaatgaaggtgtgctgctgatagagaaactcaaagccgtggactatgag
taccgtgaagaggttcactggtccaagggccagggtttcctcggcatgggatcctttggg
gaggtgtaccaagtaaaagacaagcagacaggctttcagtgtgcagccaaaaaggtgcgc
gttgaaaacttccgtgcagaggagttgacgacatgcaccggggtggcccatgccaaaatc
cttcccttgtatggagcagtgaaggaaggcccgtgggttactattttcatagaactgatg
gaaggtgggtcgctcagccatctgctcaagcagtgtggttccctgccggaggacagggcc
ctggactacctggctcaggcgctggaaggcttggcgtaccttcactctcgcaacgtcctc
catggcgacatgaaagccgacaatgtcctcttatccagtgacagaagccacgccgttctc
tgtgactttggccacgcggctcacctccggccagacagcactgggaagtatgtggtgaca
ggggattatgtccttggcacggagacccacctggcccctgaggtggtgatgggaaagtgt
tgcgacttgaaggtggacgtctggagcagctgctgcatgttgctgcatctgctgaacggg
tgtcacccatggacccggtacttcaatcaccctctgtgtctcaagatagccaaagaacca
ccccctctgaaggaaatcccgccctcctgtcacccattcactgtgaatgtgattcaggcc
ggcctgcagaaggagccccagaagcgggctggtgccgcagagctgagagttaaagcctgt
gcagctttggaacaggtggggggcctgaagagcccctggggaggagaacgcagagagccc
aggcaccccccgtgggcaccaagccccacgttcccagaccacccacaaacagccgggccg
gtgcccgagactcccgtgagcctcacaccatttgccagaagccccggcccacccctcaac
cctcagggactactggagaagacccagttcacctcctcgagcccgcgcaaggaatggttg
cagccgtgggattctgccccgctcggcaccaagcgaggcagctggcgagactggcgagac
gccactttggagcaggagttccagcagctggaactagagctggttctgaaccgcctggct
catcccgtctgcctggaggagcaggagcaaatcctttcgtgcctcagcctgggcagtccc
ctcctgccggatgccagcgacaagggctcgatgaaagcactctctctcagcctgaaggac
accatgagttcgggcgtgcattcgtggagcagccagccaaacgggcagagccacagctgg
aacagctggctgcatcgcagcagaccgacggagacgccgccttccttggacggggtgaaa
attgagatccacttgctcagcggggaggctctccatatccgtgaattccgtggagccaag
gtgggacaggtggccactgggatcagcagccagatcccagcctctccgttcagctttttc
accaaggaaggccagccggttcattgtgacgtggaggtccccgattcaggcatcgagctc
cagtgcattctggctcccgactgcagctctggctggcgatggagagtcaggcgggggcag
ctggagatccggtcctag

DBGET integrated database retrieval system