KEGG   Gekko japonicus: 107125993
Entry
107125993         CDS       T04299                                 

Gene name
IL17D
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
gja  Gekko japonicus
Pathway
gja04060  Cytokine-cytokine receptor interaction
gja04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107125993 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107125993 (IL17D)
Cytokines and growth factors [BR:gja04052]
 Cytokines
  Interleukins
   107125993 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 107125993
NCBI-ProteinID: XP_015284967
LinkDB
Position
Un
AA seq 226 aa
MLQNVDAHAPKHPFSLPSLLLQVWVLVGTLLCGLHLLGLEAFKVGKRPMRTRACADRPEE
LLEQLYGRLTAGMLSAFHHTLQLEPLEKEHNITCPTGSRSAVDKKYRLPINLNSVSPWSY
RISYDPTRYPKYIPEAYCLCKGCLTGVYGEENFHFRSTPVYMPTVILRRTTSCTGGRYIY
TEDYVTIPVGCTCIPEHEKEADGVNSSIDKQVAKLPVNQKDKPASE
NT seq 681 nt   +upstreamnt  +downstreamnt
atgttgcagaacgttgatgcgcatgctccaaagcatcctttctcgcttccttctctgctg
ttgcaggtgtgggtgcttgtggggacgctcttatgcggactgcatctcctggggttagag
gctttcaaggtgggcaaacgccccatgcggactcgagcctgcgccgaccggcctgaggag
ctcctcgaacagctgtatgggaggcttacagcgggcatgctcagtgccttccaccacacc
ttgcagctggagccgctggaaaaagagcacaacatcacttgcccgacgggaagcaggtca
gctgtggataagaagtaccgcctccccatcaatctcaacagtgtctccccttggtcatac
agaatttcctatgatcccacaaggtatccaaagtacattcctgaagcgtactgtctgtgt
aaaggctgccttactggagtttacggggaagagaatttccactttcgaagcaccccagtg
tacatgccaacggtaatcttgcgccgcaccacatcctgcaccggaggccgctatatttac
actgaggattatgtcactatccccgtgggctgcacctgcatcccagaacacgaaaaagaa
gcagatggtgtcaattccagtatagacaagcaagtggcgaaactcccggtgaatcagaaa
gacaagccagcatcagaatga

DBGET integrated database retrieval system