KEGG   Gekko japonicus: 107126169Help
Entry
107126169         CDS       T04299                                 

Gene name
BTD
Definition
(RefSeq) biotinidase
Organism
gja  Gekko japonicus
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 107126169
NCBI-ProteinID: XP_015285181
LinkDB All DBs
Position
Un
AA seq 170 aa AA seqDB search
MADITWGTTCILILFFEVLPVDVHTGGHYIAAVYEHHVILNPNPTIVTDRQSALELMNRN
LDIYEQQVILAAKQGAKIIVFPEDGVQGFNFTRTSIYPYLDLIPDPDSLTWNPCKERYLF
KDTEVLHRLSCLAQKNKVFIVANIGTKQPCKHSDSKCPPDGRQIWTLHLL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcagacattacttggggcaccacctgcatactcattctcttctttgaagttctcccc
gtagacgtccacaccgggggacattacatagctgctgtgtatgaacatcatgtcatcttg
aatcccaatccaaccatagttactgaccgacagtctgctttagagctgatgaacagaaac
ctagatatttatgagcagcaagtgatccttgctgctaaacagggagcaaaaatcattgtt
tttcctgaagatggagttcaaggcttcaatttcaccaggacatccatttatccttacttg
gatttaattcctgatcctgattctctgacttggaatccatgcaaagaaagatacttgttc
aaggacactgaggttcttcatcgacttagctgtctggcacagaagaacaaagtgtttatt
gtggccaacataggaactaagcagccctgcaagcacagtgattccaagtgcccaccagat
ggaaggcaaatttggactcttcacttgctttga

DBGET integrated database retrieval system