KEGG   Geobacillus genomosp. 3: M493_01385Help
Entry
M493_01385        CDS       T02798                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00473  D-Alanine metabolism
gjf00550  Peptidoglycan biosynthesis
gjf01100  Metabolic pathways
gjf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M493_01385 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M493_01385 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    M493_01385 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gjf01011]
    M493_01385 (ddl)
Enzymes [BR:gjf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M493_01385 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:gjf01011]
 Precursor biosynthesis
  Amino acid ligase
   M493_01385 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AGT30637
UniProt: S5Z0Z6
LinkDB All DBs
Position
205730..206824
Genome map
AA seq 364 aa AA seqDB search
MRTRVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPEGQWIRGKRLTGPVEE
VKQLQFTSTATAMIPVSLNQVPASESSPADSEETIDVIFPLLHGPNGEDGTVQGLLEMLN
LPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYVAVTKYDWQKGGEAVYDRIEQELGYP
CFVKPANAGSSVGISKCKQRGDLHQAFAQAFKYDRKIIIEEAIVGREIEIGVIGNDEPIC
SVVGEIVPKKEFYDYEAKYEDGQTELIIPAKVTPEQYETIKEMAIAAFKALDLSGLVRAD
FFLAEDGTVYINEINTMPGFTPYSMFPLLWQHSGVPYPELIERLIALALERHQEKQTITY
TFEK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgagagtcggagtgttgtacggcgggaaatcgccggaacatcaagtgtcgttg
tcaacggcgatggcagtgatgaacgccattgatcctcataaatttgatgtgattccgatt
tatattacccctgaaggacagtggatcagaggaaaacgattgactggaccggtcgaagaa
gtgaaacagctgcagttcacgtcgacagcgacggctatgatcccggtatctttaaaccag
gtgccggcgtcggaatcgtcgcctgcggacagcgaggaaacgatcgacgtcatcttcccg
cttttgcatgggccaaacggcgaagacggaactgtacaaggcctgctcgaaatgttaaac
ctcccgtacgtgggcaacggcgtgcttgcctcggccgtcggcatggataaggtgatgatg
aaaaacttgtttgcccaagccgggctgcgccaggcgaaatatgtagcggtgaccaaatat
gactggcaaaaaggcggggaagccgtctacgaccggatcgaacaagagcttggctacccg
tgctttgtcaaaccggccaatgccggatcgagcgtcggcatttcgaaatgtaaacagcgc
ggcgatttgcaccaagcgtttgctcaggcgtttaagtatgaccggaaaatcatcattgaa
gaagcgatcgtcggccgggagatcgagatcggcgttatcggcaatgatgaaccgatttgt
tcggtcgtcggagaaattgtgccaaaaaaggaattttacgactatgaggcgaaatatgaa
gacgggcaaacggaattaattattcctgccaaagtgacgccagagcagtatgagacgatc
aaggaaatggccattgccgcgtttaaagcgctcgacttgtccgggctcgtgcgtgccgac
tttttcctcgccgaagatggcacggtttatattaacgaaatcaatacgatgccaggattt
acgccatacagcatgttcccgcttctttggcagcacagcggcgtgccgtatccggaactg
atcgagcgcctcattgcgctggctctagaacggcatcaagaaaagcagacgattacgtac
acatttgaaaaataa

DBGET integrated database retrieval system