KEGG   Geobacillus genomosp. 3: M493_01420Help
Entry
M493_01420        CDS       T02798                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00473  D-Alanine metabolism
gjf01100  Metabolic pathways
gjf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M493_01420
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    M493_01420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gjf01011]
    M493_01420
Enzymes [BR:gjf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     M493_01420
Peptidoglycan biosynthesis and degradation proteins [BR:gjf01011]
 Precursor biosynthesis
  Racemase
   M493_01420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGT30644
UniProt: S5YVC5
LinkDB All DBs
Position
213036..214190
Genome map
AA seq 384 aa AA seqDB search
MDDFHRDTWAEIDLDAIHDNVANLRRFLPDGTRVMAVVKANAYGHGDAQVAETALEAGAS
YLAVAFLDEALALRKKGVNAPILVLGASRPMDVALAARHRIALTVFRADWLEQASSVYTG
PDPVYLHLKMDTGMGRLGVKDGEETKRIMTLINRHPRFILEGAYTHFATADELNTDYLSY
QYSRFLHMLEWLPARPPLVHCANSAAALRFPDRAFNMVRFGISMYGLAPSTDIKPLLPYE
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAKAEEWIGTIPIGYADGWLRRLQHFHVLVN
GQKVPIVGRICMDQCMIRLPEPLPIGTKVTLIGHQGDETISIDDVARHLGTINYEVPCTI
SYRVPRIFFRNKRIMELRNAVCHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgattttcaccgggatacatgggcggaaattgacttggatgccattcacgacaac
gtcgcgaatttgcgccgctttttgccggatggcacgcgggttatggccgttgtaaaggcg
aatgcctacggacatggtgacgcccaagtagcggaaacggcgctagaagccggcgcttcc
tacttagccgtcgcttttttggacgaggcgctcgctttaaggaaaaaaggtgtcaatgca
cccattttagtgctcggggcgtcccggccgatggatgtggcgctagccgctcgacatcgt
attgcgctaactgtgtttcgtgccgattggttagaacaggcgtcatctgtttacaccggt
ccggacccggtttacctccatttaaaaatggataccggaatgggaaggcttggggtaaaa
gacggggaggagacaaagcgcattatgacgctgattaatcgccacccccgctttatcctt
gaaggtgcatacacgcattttgcgacggccgatgaattgaacacagactatctttcttat
caatacagccgctttttgcatatgcttgaatggctgccagcgcggccgccgctcgttcac
tgtgccaacagcgcggcggcgctccgcttccccgatcgggcattcaatatggttcgcttt
ggcatttccatgtatgggctcgccccgtcgacagacatcaagccgctgcttccatacgaa
ctaaaggaggcattctcgctccatagccgcctcgtacacgtgaaaaagctgcaaccgggt
gaaaaggtgagttacggagcaacatataccgcaaaagcggaagagtggatcggcacgatc
ccgatcggctatgcggacggatggctgcgccgcctgcaacattttcatgtgcttgtgaac
ggacaaaaggtgccgattgtcgggcgcatttgcatggatcaatgcatgatccgcctgcct
gaaccgttgccaatcggcacaaaggtgacactcattggccatcagggagatgaaaccatt
tccatcgatgacgtcgcccgccatttgggaacgattaattatgaagtgccttgtacgatc
agttaccgcgtgccccgtatttttttccgaaataagcgtataatggaattgagaaatgct
gtttgtcacgggtga

DBGET integrated database retrieval system