KEGG   Geobacillus genomosp. 3: M493_06065Help
Entry
M493_06065        CDS       T02798                                 

Definition
(GenBank) chromosome partitioning protein Smc
  KO
K03529  chromosome segregation protein
Organism
gjf  Geobacillus genomosp. 3
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gjf03036]
    M493_06065
Chromosome and associated proteins [BR:gjf03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    M493_06065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_15 AAA_23 AAA_29 AAA_13 Rootletin YojJ SbcCD_C ABC_tran
Motif
Other DBs
NCBI-ProteinID: AGT31509
UniProt: S5YXT3
LinkDB All DBs
Position
1087613..1091200
Genome map
AA seq 1195 aa AA seqDB search
MVKHYTMFLKRLDVVGFKSFADRVSIDFVPGVTAVVGPNGSGKSNITDAIRWVLGEQSAK
SLRGAKMEDVIFAGSDSRKPLNVAEVTITLDNEDGFLPLEYQEVSVTRRVYRSGESEFFI
NRQPCRLKDIVDLFLDSGLGKEAFSIIGQGRVEEILSSKPEERRTIFEEAAGVLKYKLRK
KKAETKLAETQDNLHRVNDILHELGQQLEPLQMQASIAKEYLEKREELERFEVALMVHDI
EQLHRQWSELKETLDEHQREEGALAAALQKMEAHIEQLRDQMAAIDESVDGLQQVLLLAS
EELEKLEGRKEVLKERKKNAEKRKGQLDEAAAALTAKRRRLAEQLHSEQAMLAELEADAA
ALEKIVKEKQASLSAYEMDIDEEIERRKGDYIDLVHEQAALKNERMHLEQGINKLRARQV
ALDEANRHHLAEREQLEQRWNALLAEQSRLEQAIAEARRHQTALAAACAAQKTELEQKET
LLHQARQYRQQTKARKQWLEEMQHDYAGFFQGVKEVLKVRDRLPGIHGAVVELIRVPDRY
ETAIETALGGAMQHIVVDNEAAARQAIHYLKTNGYGRATFLPLDVIQARALPERERAAIS
GHPAFVGIAGELVEHDRAYAAAMAHLLGHVIVAVDLKGANELAKLLQYRYRLVTLDGDVV
SPGGAMTGGGATKKTASLLSRNRELETLVVKLQEMDGKIAQLERDIAVKQRERAEREREA
DALGQELVRLQQALQAQKDEQRELEWQKKRIDERLALYDEEKANGEREIAELNGRLHIID
GRLQQLAEKLQAIDEDIHRLQAQKQTEQTTKEALQAAITEKKIALAETRERVKHARRKAE
ELEAELADTDSELRAAEQERAALAAEMNTPAWNEDELEEQRRQKLEDKQKTIELIASRRE
QRLDCQERLEHLEREWKEAKRQHKQLAEAMKDEEVKLNRLDVELETLLARLREEYGLSFE
AARSTYPLHIEAGEARKRVKLIKRAIDELGTVNLGAIDEYERVSERHRFLSEQKADLEEA
KATLHQVIREMDEEMKKRFFSTFEQIRTHFAEVFRELFGGGRADLRLTEPNDLLGTGVEI
VAQPPGKKLQHLSLLSGGERALTAIALLFSILKVRPVPFCVLDEVEAALDEANVQRYAQY
LKRFSRGTQFIVITHRKGTMEEADVLYGVTMQESGVSKLASVRLEDSSKELVQSS
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcattataccatgttcctgaaacgattagatgtggttggcttcaaatcgttc
gccgaccgcgtatcgattgactttgttcccggtgtgacggcggtcgtcgggccgaacgga
agcggcaaaagcaacattactgatgcgatccgctgggtgctcggcgagcagtcggccaaa
tcgttgcgcggggcgaaaatggaagacgtcatttttgccggcagcgattcgcgcaagccg
ctgaacgtggccgaagtgacgatcacgctcgacaacgaagatggctttttgccgctcgag
tatcaagaagtgagcgtcacccggcgcgtctaccgctccggggaaagcgagtttttcatc
aaccgccagccgtgccgcctaaaagatattgtcgacttgtttcttgactccgggcttggc
aaggaggcgttctcgatcatcggccaaggccgggtcgaggaaattttaagcagcaagccg
gaagagcggcgcaccatttttgaagaagcggccggtgtgttgaaatacaagctgcgcaaa
aaaaaggcggaaacgaaactcgcggaaacgcaagacaacttgcaccgcgtcaacgatatt
ttgcatgagctcgggcagcagctcgaaccgctccagatgcaggcgtcgatcgccaaagag
tatttagaaaaacgcgaggagcttgagcggtttgaagtggcgctcatggtgcacgatatc
gagcagctgcaccggcaatggagcgagctgaaggagacgctcgatgagcaccagcgagag
gaaggggcgctggcggcggcgctgcaaaaaatggaggcccatatcgagcagctgcgcgac
caaatggcagctatcgatgaatcggttgacggcttgcaacaagtgctgctgttggcgagc
gaagagcttgaaaagcttgaaggccggaaagaagtgctgaaagagcgaaaaaaaaatgca
gaaaagcggaaggggcagcttgatgaggccgctgctgccttaacggcgaaacggcgccgc
ctcgccgaacagcttcattcggagcaagccatgctcgccgagctcgaagcggacgccgcg
gcgcttgagaaaatagtaaaagagaaacaagcgtcgctttcggcgtatgaaatggacatt
gacgaagaaatcgagcggcgaaaaggcgactacattgaccttgttcacgaacaggcggcg
ttgaaaaatgagcgcatgcatctagaacagggcatcaacaagctgcgcgccaggcaggtg
gcgttggacgaagcgaaccgccatcatctcgccgaacgcgaacagctcgaacaaaggtgg
aacgccttattggctgagcaatcccgcctcgaacaagccatagcggaagcgcgccgccat
caaaccgctctcgccgccgcctgtgcggcgcaaaaaacagagctcgaacagaaagaaacg
ttgttgcatcaggcgcgccaatacaggcagcaaacaaaagcgcgcaagcaatggcttgag
gagatgcaacacgattacgccggctttttccaaggagtgaaagaagtattaaaagtgcgc
gaccggctgcccggcattcatggcgcggtcgttgaactaatccgcgtgccggaccgctat
gaaacggcgattgaaacggcgctcggcggcgcgatgcagcacattgtcgtcgacaacgaa
gcggcggcgcgtcaggccattcattatttgaaaacgaacggctacgggcgggcgacgttt
ttgccgcttgacgtcatccaagcgcgcgccttgccagagcgggaacgagcggcgattagc
ggccatccggcgtttgttggcatcgccggcgaactcgtcgagcacgaccgcgcatatgcg
gcggcgatggctcatttgctcggtcatgtgatcgtggcggttgacttaaaaggagcaaac
gagctcgccaaacttcttcagtaccggtaccgtctcgtgactcttgacggtgatgttgtc
agccccgggggagcaatgaccggcggcggggcaacgaaaaagacggcctcattgttaagc
cgaaaccgtgaactcgaaacactcgttgtcaaactacaggagatggatggaaaaatcgcg
cagcttgagcgcgacattgccgtgaagcagcgcgaacgagcggaacgggaacgagaggcg
gacgcgctcgggcaggagcttgtcaggctgcaacaagcgctgcaggcgcaaaaagatgaa
cagcgcgaacttgaatggcaaaaaaagcgaatcgatgagcggctcgccttatacgacgaa
gaaaaagcgaacggcgagcgtgaaatcgcggagctgaacggccgcttgcacatcattgac
ggacggcttcagcagcttgccgagaagctgcaggcgatcgatgaggacatccatcgcctg
caggcgcaaaaacagacggaacaaacgacaaaagaggcgctgcaagccgcaatcactgag
aaaaaaatcgccctggccgaaacgagggagcgggtgaaacatgcgcgccggaaagccgaa
gagctggaagccgagctggcggacaccgatagcgaacttcgggcggccgaacaagagcgg
gccgctttggccgcagaaatgaacacaccggcgtggaacgaagatgaacttgaagagcag
cggcggcaaaagctagaagacaagcaaaaaacgattgaactgatcgctagccgccgtgag
caacggcttgactgccaggagcggcttgaacatttggagcgggaatggaaagaggcaaag
cggcagcataaacaactcgctgaggcgatgaaagacgaggaagtgaagctgaaccggctg
gatgtggagcttgagaccttgcttgcccgcctccgcgaagagtacggtttgtcgtttgaa
gcggcccgctccacgtatccgcttcacatcgaagccggggaggcgcgtaagcgggtgaag
ctgatcaagcgcgccattgatgaacttggcactgtcaatttaggggcgatcgacgaatat
gagcgcgtgtcggaacggcatcgttttttaagtgaacaaaaagctgatttggaagaagcg
aaggcgacgcttcaccaagtgattcgtgaaatggacgaagaaatgaaaaaacggtttttc
tcgacgtttgaacaaatccgcactcattttgccgaggtgtttcgcgagttgtttggcggc
gggcgcgctgatttgcggctgaccgagccgaacgacctgctcgggacgggggtggagatc
gtcgcccagccgccggggaaaaagttgcagcacttaagcttgctctcgggcggtgagcgg
gcgctgaccgcgatcgcgctcttattttcgattttaaaagtgcgcccggtgccgttttgt
gtcctcgatgaagttgaggcggcgcttgatgaggcgaacgtgcaacgctacgcccaatat
ttgaagcggttcagccgcggcacgcagtttattgtcatcacccatcggaaagggacgatg
gaagaggcggacgtgctgtatggcgtcacgatgcaagagtcgggcgtctcgaaactcgct
tccgtccgtttggaagattcttcgaaagagctcgttcagtcgtcatag

DBGET integrated database retrieval system