KEGG   Geobacillus genomosp. 3: M493_12775Help
Entry
M493_12775        CDS       T02798                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gjf  Geobacillus genomosp. 3
Brite
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M493_12775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AHSP
Motif
Other DBs
NCBI-ProteinID: AGT32801
UniProt: S6A350
LinkDB All DBs
Position
complement(2379292..2379906)
Genome map
AA seq 204 aa AA seqDB search
MPFELPALPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGQADLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELADAINQKFGSFAAFKDEFS
KAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNVVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaattgccggcattaccgtatgcgtatgatgccttggagccgcacatcgat
aaagaaacgatgaacatccatcacacgaagcaccataacacatatgtgacgaatttgaat
gcggcgctcgaagggcaggcggatttgcaaaacaaatcgctcgaagaattgctcagcaat
ttggaagcccttccggaaagcatccgtacagcggtgcgcaacaacggcggcggccatgcg
aaccattcgcttttctggacgattttgtcgccaaacggcggcggcgagccgacaggcgaa
ctcgctgatgccatcaaccaaaaattcggcagctttgccgcgtttaaagacgaattttca
aaagcggcggccggccgtttcggttccggttgggcgtggcttgtcgtcaacaatggcgag
ttggaaatcacaagcacgccgaaccaagattcgccgatcatggaaggcaaaacaccgatc
cttggattggatgtttgggagcatgcgtactacttgaaataccaaaaccgtcgtccggaa
tacattgccgcgttctggaacgttgtcaattgggacgaagtggcgaaacgctacagtgaa
gcaaaagcgaaataa

DBGET integrated database retrieval system