KEGG   Geobacillus genomosp. 3: M493_13345Help
Entry
M493_13345        CDS       T02798                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gjf  Geobacillus genomosp. 3
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M493_13345
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     M493_13345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO NAD_binding_7 AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin NAD_binding_8 K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AGT32910
UniProt: S5ZEZ3
LinkDB All DBs
Position
complement(2479287..2480816)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLMENDIVLTVSAGDDPVSRDLLALVDELTAMSPKIKVEKAKLER
TPSFSVNRVGENTGVTFAGVPLGHEFTSLVLALLQVSGRPPKVDEKVMNQIQNLKGTYRF
ETYVSLTCHNCPDVVQALNVMSVLNPNISHTMIDGAAFKEEVEQKGIMAVPTVFLNGKPF
ASGRMSLEEILAKLGSTVDASDFANKEPFDVLVVGGGPAGAAAAIYAARKGIRTGIIAER
FGGQILDTLGIENFISVKYTEGPKLAASLEEHVKHYNVDIMTLQRAKRLEKKDLIEVELE
NGAVLKSKTVIIATGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIAKHVTVLEFAPELKADAVLQDRLYSLPNVTVIKNAQTKEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRIGEIIVDKRSATSVDGVFAAGDC
TDSAYKQIIISMGAGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggatgctgacatcaaagcccaattggcccagtatctacaattaatggagaat
gatattgttttaacagtgagcgcgggagacgatccagtttcccgcgatctccttgcttta
gtcgatgaattaacggccatgtcgccgaaaattaaagtagaaaaagcgaagctcgaacgg
acgccgagcttcagcgtcaatcgggttggcgaaaatacgggcgtcacattcgccggcgtt
ccgttggggcatgagtttacttcgctagtgctggcgttgcttcaagtgagcggaagaccg
cctaaggttgacgagaaagttatgaaccaaattcaaaacctcaaaggcacttatcgtttt
gaaacatacgtcagcctaacgtgccataactgcccggatgtcgttcaggcgttaaacgtg
atgagcgtattaaatccgaacatttcacatacgatgatcgacggggcagcgtttaaagaa
gaagtagaacaaaagggaattatggctgtgccgaccgtctttttaaatggcaagccgttt
gcaagcggccgcatgtcgcttgaggaaattcttgcaaaactcggaagcacggtagacgct
tctgactttgccaataaagaaccgttcgatgtgctcgttgtcggcggcggtccggccggg
gctgcggcggcgatttacgcggcgcgaaaaggcattcgcaccggcattattgctgagcgg
tttggcggacaaattctcgatacgctcggcattgaaaactttattagcgtgaaatacacg
gaaggtccgaaacttgccgcaagccttgaagagcatgtgaaacattataatgtcgacatc
atgaccttgcagcgtgcgaaacggttggaaaagaaggatctcattgaagtggagcttgaa
aacggcgccgtgttaaaaagcaaaacggtcattatcgcgacgggcgcccgttggcgcaat
cttggcgtaccaggcgaggaagagttcaaaaacaaaggcgtggcctattgcccgcattgc
gacggcccgctgtttgaaggcaagcacgtcgcggtcatcggcggcggcaactccggcgtg
gaagcggcgattgacctcgccggcattgccaaacatgtgaccgtgctcgagtttgctccg
gagttgaaagcggacgctgttttgcaggatcggttgtacagcttgccgaacgtgacggtc
atcaaaaacgcgcaaacgaaagaaattaccggtacagataaagtgaatggccttacgtat
atagaccgggaaacaggggaagagcaccatattgagttgcaaggcgtattcgttcaaatc
ggtctcgtgccgaatacagagtggctagaagggacggttgaacggaaccgcatcggtgaa
attatcgtcgataaacgcagtgcgacaagtgtcgacggcgtctttgccgcgggcgattgc
acggatagcgcctataagcaaatcattatttcgatgggggcgggcgctaccgccgcattg
agcgcgtttgattacttgattcgtcattag

DBGET integrated database retrieval system