KEGG   Geobacillus genomosp. 3: M493_13370Help
Entry
M493_13370        CDS       T02798                                 

Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00230  Purine metabolism
gjf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    M493_13370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gjf04147]
    M493_13370
Enzymes [BR:gjf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     M493_13370
Exosome [BR:gjf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M493_13370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: AGT32915
UniProt: S5ZEZ8
LinkDB All DBs
Position
complement(2484823..2485335)
Genome map
AA seq 170 aa AA seqDB search
MDLKQYITIVPDFPKPGILFKDITTLMDNGKAYKYATDQIVQYAREKQIDIVVGPEARGF
IIGCPVAYALGVGFAPVRKEGKLPREVVRVEYGLEYGTDVLTMHKDAIKPGQRVLITDDL
LATGGTMRATIDLVEQLGGTVAGLAFLIELTELGGRKKLEGYDILTLMQF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaacagtacatcacgatcgtgccggattttccaaaaccgggcattctattt
aaggacattacgacgctaatggacaacggaaaagcgtacaaatatgctactgaccaaatc
gtccaatatgcgcgcgaaaaacaaatcgatatcgtcgtcggtccggaagcgcgcggcttt
attatcggctgcccggtcgcctatgcgcttggcgtcgggtttgcgccggtgcgcaaagag
ggaaagctgccgcgcgaagtcgttcgtgtcgaatacgggttagagtatgggacggacgta
ctgacgatgcataaagatgccatcaagccaggccagcgcgtgttaattaccgacgacttg
ctagcgacaggcggaacaatgcgggcgacgatcgatttggtcgaacagcttggcggcacg
gtggccggtttggcgtttttaattgaattgacggaacttggcgggcgtaaaaaattggaa
ggctacgatattttgacgctcatgcagttttaa

DBGET integrated database retrieval system