KEGG   Geobacillus genomosp. 3: M493_14185Help
Entry
M493_14185        CDS       T02798                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00020  Citrate cycle (TCA cycle)
gjf00480  Glutathione metabolism
gjf01100  Metabolic pathways
gjf01110  Biosynthesis of secondary metabolites
gjf01120  Microbial metabolism in diverse environments
gjf01130  Biosynthesis of antibiotics
gjf01200  Carbon metabolism
gjf01210  2-Oxocarboxylic acid metabolism
gjf01230  Biosynthesis of amino acids
Module
gjf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gjf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M493_14185
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M493_14185
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     M493_14185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGT33076
UniProt: S6A3G2
LinkDB All DBs
Position
complement(2646852..2648123)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVTNGVLNVPNHPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFEGVPSPVKRPQDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPVSEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAQYDRIVEAEGKEAANKAMADAEAAGKIIVKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIQAMEKTIASKVVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggggaaaaaattactgtcaccaatggtgtgctcaacgttccaaaccatccg
atcattccgttcattgaaggggacggaaccggcccggacatttgggcggccgcttcgcgc
gtgttggaagcagcggtggaaaaagcgtataaaggcgagaaaaaaatcgtctggaaggaa
gtgcttgccggcgaaaaagcgtacaaactgacgggaagctggcttccggatgaaacgctc
gagacgatccgtgaatacataattgccattaaaggcccgttgacgacgccggtcggcggg
gggatccgttcgctcaacgtcgcgctccgtcaagagcttgatttgttcgtctgcctgcgc
ccggtccgctattttgagggcgttccgtcgccggtgaaacggccgcaagacaccgacatg
gtcattttccgcgaaaacacggaagatatttacgccggcatcgagtatgcgaaagggacg
ccggaagtgaaaaaagtgatcgactttttgcaaaacgaaatgggcgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcatcaaaccagtttccgaagaaggaacaaaacggctc
gtgcgcgcagcgatcaactatgcgatcgaacacggccgcaagtcggtcacactcgtccat
aaagggaacatcatgaagttcacagaaggcgcatttaaaaactggggttatgagctggct
gaacaagagttcggcgacaaagtgtttacatgggcgcaatatgaccggatcgtcgaagcc
gaaggaaaagaagcggcaaacaaagcgatggcggacgcggaagcggccggcaaaatcatc
gtcaaagacgtcattgctgacatcttcctgcagcaaattttgacgcgtccgcgcgaattt
gacgtcattgcaacgatgaacttaaacggcgactacatttccgatgcgctcgcggctcaa
gtcggcggcatcggcatcgcgccgggggcgaacattaactatgaaaccggccatgccatt
ttcgaagcgacgcacggcacagcgccgaaatacgccggacttgacaaagtcaatccgtcg
tccgttattttatcgggcgtcatgatgtttgagcatctcggctggaacgaagcagcgaaa
ctcatcatccaagcgatggaaaaaacgatcgcttccaaagtcgtgacgtacgacttcgcc
cgcctgatggaaggggcaaccgaagtgaaatgttcggaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system