KEGG   Geobacillus genomosp. 3: M493_14210Help
Entry
M493_14210        CDS       T02798                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00010  Glycolysis / Gluconeogenesis
gjf00030  Pentose phosphate pathway
gjf00051  Fructose and mannose metabolism
gjf00052  Galactose metabolism
gjf00680  Methane metabolism
gjf01100  Metabolic pathways
gjf01110  Biosynthesis of secondary metabolites
gjf01120  Microbial metabolism in diverse environments
gjf01130  Biosynthesis of antibiotics
gjf01200  Carbon metabolism
gjf01230  Biosynthesis of amino acids
gjf03018  RNA degradation
Module
gjf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gjf_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M493_14210
   00030 Pentose phosphate pathway
    M493_14210
   00051 Fructose and mannose metabolism
    M493_14210
   00052 Galactose metabolism
    M493_14210
  09102 Energy metabolism
   00680 Methane metabolism
    M493_14210
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    M493_14210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gjf01009]
    M493_14210
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gjf03019]
    M493_14210
Enzymes [BR:gjf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     M493_14210
Protein phosphatases and associated proteins [BR:gjf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     M493_14210
Messenger RNA biogenesis [BR:gjf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     M493_14210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PucR NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AGT33081
UniProt: S6A3G4
LinkDB All DBs
Position
complement(2653091..2654050)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTMLYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
AKQHTIDQRMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtgtcttgacaagcggcggcgactcgccggggatgaacgcggccatt
cgcgctgtcgtccgcaaggcgatttaccacggcgtagaagtgtatggcgtctaccacggc
tatgccgggctgatcgccggcaacattaaaaaactggaagtcggcgatgtcggcgatatt
attcaccgcggcggtacgatgctatatacagcccgctgtccggagtttaaaacagaagaa
gggcagaaaaaagggattgaacaattaaaaaagcacggcattgaagggctcgtcgtcatc
ggcggcgacgggtcgtatcaaggagcgaaaaaattgacggagcacggttttccatgcgtc
ggcgtaccgggcacgatcgacaacgacattccgggcactgattttacgatcgggtttgac
accgcgctcaatacagtcattgatgccatcgacaaaatccgcgatacagcaacgtcgcat
gaacggacgtacgtcattgaagtcatgggccgccatgccggcgacatcgccttatggtcc
gggctggccggcggggcggaaacgattttaattccggaagccgattacgacatgaacgac
gtcatcgcccgcctgaagcgcggccatgagcgcggcaaaaaacatagcatcatcatcgtg
gcggaaggggtcggcagcggcgtcgacttcggccggcaaatccaagaagcgaccggcttt
gagacgcgcgtgacggtgctgggccacgtgcagcgcggcgggtcgccgacggcgtttgac
cgcgtgctggcgagccgcctcggcgcccgtgcggtggagttgcttttagaaggaaaagga
ggccgctgtgtcggcattcaaaacaaccagctcgtcgaccatgacattgccgaagcgtta
gcgaaacaacatacgatcgatcagcggatgtacttattgtcgaaagaactgtccatctaa

DBGET integrated database retrieval system