KEGG   Geobacillus genomosp. 3: M493_14435Help
Entry
M493_14435        CDS       T02798                                 

Definition
(GenBank) acyl--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00010  Glycolysis / Gluconeogenesis
gjf00620  Pyruvate metabolism
gjf00630  Glyoxylate and dicarboxylate metabolism
gjf00640  Propanoate metabolism
gjf00680  Methane metabolism
gjf01100  Metabolic pathways
gjf01110  Biosynthesis of secondary metabolites
gjf01120  Microbial metabolism in diverse environments
gjf01130  Biosynthesis of antibiotics
gjf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M493_14435
   00620 Pyruvate metabolism
    M493_14435
   00630 Glyoxylate and dicarboxylate metabolism
    M493_14435
   00640 Propanoate metabolism
    M493_14435
  09102 Energy metabolism
   00680 Methane metabolism
    M493_14435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gjf01004]
    M493_14435
Enzymes [BR:gjf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M493_14435
Lipid biosynthesis proteins [BR:gjf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M493_14435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGT33126
UniProt: S6A3I0
LinkDB All DBs
Position
complement(2698329..2699924)
Genome map
AA seq 531 aa AA seqDB search
MRREELIAPERYNLTSEMERHATADPDRIALKWENEQGETREITYGRLMARANQIGNAFL
SRGLQKGDKVLVMVPRLIEAYEVYVGALKAGLVVIPSSEMLRTKDLQYRLFHGEVKAIVA
YEPYLGEFAPIDGIDQLLKFSIGEHVHDGWLPLEACMAKESEVLEAADTSRDDMAFLSYT
SGTTGNPKGVVHCHGWAYAHLRTAAKNWLCIEEGDLVWATAGPGWQKWIWSPFLSVLGSG
ATGFVYYGRFEPETYLRLLEKYQINVLCCTPTEYRLMAKVPDIGRYDLSPLHSAVSAGEP
LNREVIDTFAKHFGIEVRDGYGQTENTLLVGVMKGMEIKPGSMGKPTPGNRVEIIDENGE
PCPPGQVGDIAVHVETPALFKHYYKDPERTAMQFRGDYYITGDKARKDEDGYFWFEGRGD
DIIISSGYTIGPFEVEDALVKHPAVKECAVVASPDEVRGHVVKAFVVLREGIDQTDPSLI
PALQEHVKQLTAPYKYPRKIEFVNDLPKTVSGKIRRVELREREARLFGRSS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgggaagaattgatcgcgcctgagcggtacaatttaacatcggaaatggaaaga
cacgcaacggctgatccggatcggatcgcgttaaaatgggaaaacgagcaaggggaaacg
cgggagattacatacggccgtctgatggcgcgcgccaatcaaattggaaacgctttctta
tcgcgcggtcttcagaaaggagacaaagtgcttgtcatggtgccgcgcctcattgaggca
tatgaagtgtatgtaggggcgctcaaagccgggctggttgtcattccgagctcggagatg
ctgcggacaaaagatttgcaataccggctgttccacggggaagtaaaggcgatcgtcgcc
tacgaaccgtatctcggcgagttcgctccgatcgatggcatcgatcaactgctcaaattt
tcgattggcgaacacgttcatgacggctggctgccgcttgaagcgtgcatggcaaaggaa
agcgaggtgcttgaagcggcagacacgtcgcgcgatgatatggcgtttttatcgtacaca
tccggcacgaccggcaatccgaaaggggttgtgcattgccatggctgggcgtacgcccat
ttgcgcacagcggcgaaaaactggctgtgcattgaagagggcgatctcgtctgggcgacg
gccggaccgggatggcaaaaatggatttggagtccgtttttgtcggtgcttggctcaggg
gcgaccggctttgtctattacggccgttttgagccggaaacatatttgcggctgctcgaa
aaatatcaaatcaatgtgctttgctgcacgccgaccgagtaccgtctgatggcgaaagtg
ccggacatcggccgctacgatttgtcccctctccatagcgccgtttcagccggtgagccg
ctcaaccgcgaagtgatcgacacgtttgccaaacatttcggcatcgaagtgcgagacggc
tacgggcagacggaaaatacgctgctggtcggcgtcatgaaaggaatggagatcaagccg
ggctcgatggggaaaccgacgccgggcaaccgcgtcgagattatcgatgaaaacggtgag
ccgtgcccgccgggacaagtcggcgatatcgccgtccatgtcgaaacgccggcgttgttt
aaacattactacaaagacccggagcggacagcgatgcagttccgcggcgattactacatc
accggcgacaaggcgcgcaaagacgaagacggctatttttggtttgaagggcgcggcgat
gacatcatcatcagttccgggtatacgatcggtccgtttgaagtcgaagacgccctcgtc
aaacatccggcggtgaaagaatgcgcggttgtcgccagcccggatgaagtgcgcggccat
gtcgtcaaggcgttcgtcgtcttgcgcgaagggatcgaccaaactgatccgtccctcatc
ccggcgttgcaagaacatgtcaaacagttgaccgccccatacaagtatccgcgcaaaatc
gaatttgtcaacgacttgccgaaaacggtgtccggcaaaatccgccgcgtcgagctgcgc
gagcgggaagcgcgcctcttcggccggtcgtcataa

DBGET integrated database retrieval system