KEGG   Geobacillus genomosp. 3: M493_14700Help
Entry
M493_14700        CDS       T02798                                 

Definition
(GenBank) MFS transporter
Organism
gjf  Geobacillus genomosp. 3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_4 HCV_NS4b PTR2 Bac_export_2
Motif
Other DBs
NCBI-ProteinID: AGT33178
UniProt: S5ZRX8
LinkDB All DBs
Position
complement(2751714..2752913)
Genome map
AA seq 399 aa AA seqDB search
MPRALWWLLVGMALNVTGASFLWPLNTIYLHEQLGQPLAVAGAVLMLNSGGSVVGSLLGG
VLFDRIGGFRTLVAGACLTMAALAGLSVWHGWPHYAVWLALVGIGSGVVFPAASAYAGAI
WPEGGRRAFNALYVAQNIGVAAGSALGGVVASYSFALVFWANVWLYAAFLATVVIGLRRV
PLPPLPKKERKRRTGDGAPRPHIRALVLLCAGYGLCWMSYVQWSTTIAAYTRELHIPVHH
YSLLWTINGALIVLGQPLLVPLVRRFMPGMKRQIVIGFAVFTVSFAMLFGASSLLQFAAS
MIVLTIAEMIVWPAIPAVVNELAPPGRTGFYQGIVNGTATAGRMIGPVLGGWVADAFGMK
PLIGLLVAFALLAAGAALVYDRGLPKRAEKAGEKTAATV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgctctttggtggctgcttgtcggcatggcgctcaacgtcacaggggcgtcg
tttttatggccgttaaacaccatttatttgcatgagcagctcggccagccgctcgccgtg
gcgggagcggtgctgatgctcaactccggcggcagcgtcgtcggcagcctgctcggcggc
gtgctgtttgaccggatcggcgggtttcgcacgctcgtggccggggcgtgtttgacgatg
gcggcgcttgccggcttgagcgtctggcacggctggccgcattatgccgtctggctggcg
cttgtcggcatcggcagcggcgtcgtctttccggcggcgtcggcgtatgccggagcgatt
tggccggaaggggggcggcgggcgttcaacgccttgtatgtggcgcaaaacatcggcgtc
gccgccggctcggcgctcggcggcgttgtcgcttcgtattcgttcgcgctcgtgttttgg
gcgaacgtgtggctgtatgccgcttttttggcgacagtcgtcatcgggctgcggcgcgtg
ccgctgccgccgctgccaaaaaaagaacggaagcgccggacgggggacggggcgccccgg
ccccacatccgcgccctcgtccttctttgcgccggctacggattgtgctggatgagctac
gtccaatggtcgacgacgatcgccgcctatacgcgcgagctccatatcccggttcatcac
tacagcctgctttggacgatcaacggcgccttgatcgtgctcggccagccgctgttagtg
ccattggtccgccgctttatgccggggatgaagcggcaaatcgtcatcgggttcgccgtt
ttcaccgtctcgtttgcgatgctgtttggcgctagctcacttttgcaatttgcggcgtcg
atgatcgtgcttacgatcgccgaaatgatcgtctggccggcgattccggcggtcgtgaac
gagctggcgccgccggggagaacgggattttaccaagggatcgtcaacggcacggccacg
gccggacggatgatcgggccggtcctcggcggttgggtcgccgatgcgttcgggatgaag
ccgctcatcgggctgcttgtcgccttcgccctgctggccgccggcgcggcgctcgtgtat
gaccgggggctgccgaagcgggcggaaaaggcgggagaaaaaacggccgcgaccgtctag

DBGET integrated database retrieval system