KEGG   Geobacillus genomosp. 3: M493_15655Help
Entry
M493_15655        CDS       T02798                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00071  Fatty acid degradation
gjf00362  Benzoate degradation
gjf00650  Butanoate metabolism
gjf01100  Metabolic pathways
gjf01120  Microbial metabolism in diverse environments
gjf01200  Carbon metabolism
gjf01212  Fatty acid metabolism
Module
gjf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M493_15655
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M493_15655
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M493_15655
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     M493_15655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGT33347
UniProt: S5Z959
LinkDB All DBs
Position
complement(2896284..2898671)
Genome map
AA seq 795 aa AA seqDB search
MAKRIRRAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPKELTKEEEAKGWTLEHPQVRNR
LANRALERMKKQKPAPLMAKDNITLIETGNFEDDFHRLADVDWIIEVVVENLEVKRSVFA
RIDEVRTPGTIVSSNTSGISIAAMAEGRSDDFQKHFLGTHFFNPPRYLKLLEIIPTEQTD
PDVVAYMKTFAEDVLGKGVVMAKDTPNFIANRIGTYGLLVTVREMMQGGYSVGEVDSVTG
PLIGRPKSATFRTLDVVGLDTFVHVANNVYDNVEGEEKDAFRVPEFMKTMLQNGWLGSKS
GQGFFLKQGKDILELNYVTMQYEPRKKLVTPAVEMAKQAKGTAAKLQTLLYAGGDRAGTL
LWNIIAPTLLYAARLVGEIADDIVAIDNAMKWGFGWEQGPFELWDAIGLEKSVRNMQAEG
RDVPAWVTDMLADGAASFYQTNNGRLFYYGQSGYTLVKENPKTIHLKRWKEQRGVVKKNA
GASLIDLGDDVALLEFHSPNNAIGTDIVQMINEALDEVNRNYKGLVIGNQGKNFCVGANL
AMMLMEAQDENFFELELAVRQFQQALMRVKYNPKPVVVAPFAMTLGGGAEVTLAASRIQA
AAETYIGLVEVGVGLIPGGGGNKELYIKQLNSLPGGADVDYVKLVAKVFETIAMAKVSTS
AAEARALGFLGSRDGVTMNGDHLLYEAKQAVLSLYEEGYRPPVRKKVPVAGESGYAAMLL
GAQSMLHSGYISEHDLKIAKKLAYVLSGGKVPYGTEVDEQYLLDLEREAFLSLIGEPKTQ
ARMQHMLVKGKPLRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcattcggcgcgccgccgtgcttgggtctggcgtcatgggttcgggcatt
gccgcccatttggcgaacgtcggcatcccgacgttattgcttgacattgtgccaaaggaa
ttgacgaaagaagaagaggcgaaaggatggacgttggaacatccgcaagtgcgcaaccgc
ctcgccaaccgggcgctggagcggatgaaaaaacaaaagccggcgccgctgatggcaaaa
gacaacatcacgctcattgaaacgggcaactttgaagatgactttcaccgccttgcggat
gtcgattggatcattgaagtcgtcgtcgaaaacttggaggtcaaacgaagcgtcttcgcc
cgcatcgacgaggtgcggacgccggggacgatcgtcagctcgaacacatccggcatttcc
atcgccgcgatggcggaagggcgctcggatgattttcaaaagcattttttaggcacccac
tttttcaacccgccgcgctatttgaagctgcttgaaatcatcccgaccgagcagacggat
ccggatgtcgtcgcctatatgaaaacgttcgccgaagacgtgctcggcaaaggcgtcgtc
atggcgaaagatacgccgaacttcatcgccaaccggatcggcacgtacgggctgcttgtc
accgtgcgcgagatgatgcaaggcggctacagcgtcggcgaagtcgattcggtcaccggg
ccgctcatcggccggccgaaaagcgcgacgttccgcacgcttgacgtcgtcgggctcgat
acgttcgtccatgtcgccaacaacgtgtatgacaacgtcgaaggggaagaaaaagacgcc
ttccgcgtgccggaatttatgaaaacgatgctgcaaaacggctggctcggcagcaaatcc
ggacaaggctttttcttgaagcaagggaaagacatcctcgagctcaattacgtcacgatg
cagtacgagccgcgcaaaaagctcgtcaccccggcggtggaaatggcgaagcaggcgaaa
ggaacggccgccaagctgcaaacgctcctttatgccggcggcgaccgcgcggggacactc
ctttggaacatcatcgcgccgaccttgctgtatgcggcgcgcctggtcggcgaaatcgcc
gatgacatcgtggcgatcgacaatgcgatgaagtgggggttcggctgggagcaaggaccg
tttgaactgtgggatgcgatcggccttgagaaatcggtgcggaacatgcaggcggaaggg
cgcgacgttccggcgtgggtgacggatatgctcgccgacggcgccgcatcgttctatcaa
acgaacaacggccggctgttctattatgggcaaagcggctatacattagtgaaagaaaat
ccaaagacgatccatttgaaacggtggaaagagcagcgcggcgtcgtgaagaaaaacgcc
ggcgcaagcctgatcgacctcggcgatgacgtggcgcttttggagttccattcgccgaac
aacgcgatcggcacggacatcgtccaaatgatcaacgaggcgcttgatgaggtgaaccgc
aactacaaagggcttgtcatcggcaatcaagggaaaaacttctgcgtcggcgcgaacttg
gcgatgatgctcatggaagcgcaagatgaaaacttctttgaactcgagcttgccgtccgc
cagttccagcaagcgctcatgcgcgtcaaatacaacccgaaaccggtcgttgtggcgccg
tttgccatgacgttaggcggcggggcggaagtgacgttggcggcttcgcgcatccaagcg
gccgccgagacgtacatcgggcttgtcgaagtcggcgtcggcttgattccgggcggcggc
ggcaacaaggagctgtacatcaaacaattgaacagcctgccaggcggcgcggatgtcgac
tacgtcaaactcgtcgccaaggtgtttgaaacgatcgccatggcgaaagtgtcgacgtcg
gcggccgaagcgcgcgcgctcggtttcttaggcagccgcgacggcgtcacgatgaacggc
gaccatctgttgtatgaagcgaaacaggcggtgctctcgctgtatgaagaaggataccgg
ccgccagtcagaaagaaagtgccggtcgccggggaaagcggctatgccgccatgctttta
ggcgcgcaatcgatgctccattccggctacattagcgagcacgatttgaagatcgcgaaa
aagttggcgtacgtcctctcgggcggcaaagtgccgtacgggacggaagtcgatgagcag
tacttgcttgatcttgagcgcgaggcgtttttgagcctgattggcgagccgaagacgcaa
gcgagaatgcagcatatgttggtgaaaggaaaaccgctccgcaactaa

DBGET integrated database retrieval system