KEGG   Geobacillus kaustophilus: GK0064Help
Entry
GK0064            CDS       T00217                                 

Definition
(GenBank) chaperonin (heat shock protein 33) (HSP33)
  KO
K04083  molecular chaperone Hsp33
Organism
gka  Geobacillus kaustophilus
Brite
KEGG Orthology (KO) [BR:gka00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gka03110]
    GK0064
Chaperones and folding catalysts [BR:gka03110]
 Heat shock proteins
  HSP33
   GK0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: BAD74349
UniProt: Q5L3S9
LinkDB All DBs
Position
78084..78974
Genome map
AA seq 296 aa AA seqDB search
MKMGDYLVKALAYNGQVRAYAARTTETVAEAQRRHQTWPTASAALGRALTAGVMMGAMLK
GEETLTIKIDGGGPIGVILVDSNARGEVRGYVTNPHVHFELNEHGKLDVARAVGKNGMLT
VVKDLGLRDFFTGQVPLISGELGDDFTYYFASSEQIPSSVGVGVLVNPDHTIRAAGGFII
QLMPGTEENTITRIEERLKQIPPVSRMIERGLSPEQLLEQLLGDGGVRVLETMPVSFVCR
CSRERIADALISLGPEEIQDIIDKEGQAEASCHFCNETYHFDKAELEQLKQLAKKE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggagactacttagtcaaagcactcgcttacaatggacaagtgagagcgtat
gccgcaagaacgacggaaactgtcgccgaggcgcaacgccgccaccaaacatggccgacc
gcctcagcggctctcggccgggcgttgaccgccggtgttatgatgggagcgatgctgaaa
ggcgaggaaacgttgacgattaaaattgacggcggcggcccgatcggcgtcattttagtt
gacagcaacgccagaggggaagtgcgtggctatgtaacgaatccacatgtacattttgag
ctgaacgagcatgggaaacttgatgtggcacgggcggtcggcaaaaatgggatgttgacg
gttgtgaaggatcttgggctgcgcgactttttcaccggacaagtgccgcttatctccggg
gagcttggcgatgattttacgtattattttgcttcgtccgaacaaattccgtcatcggtt
ggcgtcggggtgctcgtcaatcccgaccataccatccgagccgccggaggatttattatc
cagttgatgcccgggacggaggagaacacgatcactcgcattgaagagcggctgaaacaa
attccgcccgtgtcgcgcatgatcgaaagagggctcagcccggaacagctgctcgaacaa
ctgttgggagatggaggcgtccgtgtgctcgagacgatgccggtgtcattcgtctgccgc
tgttcgcgcgagcggatcgctgatgcccttatcagcctagggcccgaggaaatccaagac
atcatcgacaaagaagggcaggcggaagcttcgtgccatttttgcaatgaaacgtaccat
ttcgacaaagcggagctggaacagttgaaacaactcgcaaaaaaagaatga

DBGET integrated database retrieval system