KEGG   Geobacillus kaustophilus: GK0223Help
Entry
GK0223            CDS       T00217                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00473  D-Alanine metabolism
gka00550  Peptidoglycan biosynthesis
gka01100  Metabolic pathways
gka01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GK0223
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GK0223
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GK0223
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
    GK0223
Enzymes [BR:gka01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GK0223
Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
 Precursor biosynthesis
  Amino acid ligase
   GK0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: BAD74508
UniProt: Q5L3H2
LinkDB All DBs
Position
235403..236506
Genome map
AA seq 367 aa AA seqDB search
MKTKVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPEGQWIKGEQLTGPIEE
IKQLQFTSAATALIPVSLNQVPAADSAAGGNEETIDVIFPLLHGPNGEDGTVQGLLEILN
IPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYIAVTKYDWQKRGETVYDRIERELGYP
CFVKPANAGSSVGISKCKQRGDLKAAFIEAFQYDRKIIIEEAIVGREIEIGVIGNDEPIC
SVVGEIVPKKEFYDYEAKYEDGQTELIIPADVTKEQYETIKQMAITAFQVLDLSGLARVD
FFLAEDGAVYINEVNTMPGFTPYSMFPLLWQHSGVPYPELIERLIALALERHQEKQTITY
TFKKEKR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaagttggcgtgttatacggcggcaaatcaccggagcaccaagtatcgttg
tcgacggcgatggcggtgatgaacgccattgatcctcataaatttgatgtcattccgatt
tatattacaccggaaggtcaatggatcaagggcgaacagttgaccggaccgatcgaggaa
atcaagcagctgcaattcacttcggcggcgaccgccttgattccggtttccttgaaccaa
gttccggctgccgattcggctgcgggaggaaacgaggaaacgatcgatgtcattttcccg
cttttgcatgggccgaacggcgaagacggaacggtgcaagggttgcttgagatattgaac
attccgtatgtcggcaacggggtgcttgcttccgcggtcggcatggataaggtgatgatg
aaaaacttgtttgcgcaggccgggttgcgccaagcaaaatatatcgccgtgacgaagtac
gattggcaaaaaagaggcgagacggtgtatgaccggatcgaacgagagcttggctacccg
tgctttgtcaagccagccaacgccggttcgagcgtcggcatttccaaatgcaagcagcgc
ggcgatttaaaagccgcatttatcgaggcatttcagtatgaccgaaaaattattattgaa
gaggcgattgtcggccgcgaaattgaaatcggcgtgatcggaaatgatgagccgatttgt
tcggtcgttggcgaaattgttcccaaaaaggaattttacgactatgaagcgaaatacgaa
gacgggcaaaccgaattgatcatcccagcggacgtaacgaaagaacagtatgagacgatc
aaacaaatggccattacggcgtttcaggtgctggatttgtctggacttgcgcgcgtcgat
tttttcctcgccgaagatggcgctgtttatatcaacgaagtgaacacgatgccaggcttt
acgccatacagcatgttcccgcttctttggcagcacagcggtgtgccgtacccggagctg
attgaacggcttatcgcgctcgcattggaacgacatcaagaaaagcagacgatcacgtac
acgttcaaaaaagaaaagaggtga

DBGET integrated database retrieval system