KEGG   Geobacillus kaustophilus: GK0231Help
Entry
GK0231            CDS       T00217                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00473  D-Alanine metabolism
gka01100  Metabolic pathways
gka01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GK0231
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GK0231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
    GK0231
Enzymes [BR:gka01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GK0231
Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
 Precursor biosynthesis
  Racemase
   GK0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAD74516
UniProt: Q5L3G4
LinkDB All DBs
Position
242621..243775
Genome map
AA seq 384 aa AA seqDB search
MDEFHRDTWVEIDLDAIYDNVANLRRFLPEGTQIMAVVKANAYGHGDAQVAATALEAGAS
RLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALTVFRSDWLEKASSLYNG
STPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGVYTHFATADEVNTDYFSY
QYARFLHMLDWLPSRPPLVHCANSAAALRFSDRAFNMVRFGISMYGLAPSPDIKPLLPYE
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVG
GQRAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEVISIDDVARHLGTINYEVPCTI
GYRVPRIFFRNKRIMEVRNAVGRG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtttcaccgcgatacgtgggtggaaattgatttggacgccatttacgacaac
gtcgcgaatttgcgccgctttttgccggagggtacgcaaattatggccgttgtcaaggcg
aacgcctacgggcacggcgatgcccaagtggcggcaacggcgctcgaagcgggcgcttcc
cgcttggccgtcgcctttttggacgaggcgcttgccttacgaaaaaaaggcatcgatgcc
ccgattttagtgcttggggcgtctcgtcccgaggatgtggcgttggccgccgaacaccgc
atcgccttaaccgtgtttcgctctgattggctcgagaaggcgtcatcgctgtataacggt
tcgaccccgattcatttccatttaaagatggacacgggaatgggacggcttggggtgaaa
gacgaagaggagacaaagcgaatagcggccttgatcgatcgccatccgccctttgtgctt
gaaggggtgtatacgcattttgcgaccgctgatgaagtgaatacggattacttttcttat
caatacgcccgctttttgcatatgcttgactggctgccgtcgcggccgccgctcgttcat
tgcgccaacagcgcggcggcccttcgtttttccgatcgagcgttcaacatggttcgcttt
ggcatttcgatgtacgggctcgccccatcgccggacatcaagccgctcctcccatacgaa
ttgaaagaggcgttttcgctccatagccgccttgtacacgtcaaaaaactgcaaccaggc
gaaaaggtgagctacggtgcgacgtacaccgcgcagacggaagagtggatcggcacgatt
ccaatcggttatgcggacggctggctgcgccgcctgcagcactttcatgtgcttgttggc
gggcagcgggcgccgatcgtcggccgtatctgcatggatcaatgcatgatccgcctgccg
gagccgctgcctgtcgggacgaaggtgacattaattggccgccaaggggacgaagtcatt
tccatcgatgatgtcgcccgccatttgggcacaatcaattatgaagtgccgtgcacgatc
ggctaccgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaacgcc
gttggtcgcggatga

DBGET integrated database retrieval system