KEGG   Geobacillus kaustophilus: GK0282Help
Entry
GK0282            CDS       T00217                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A (Glu-ADT subunit A)
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00970  Aminoacyl-tRNA biosynthesis
gka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gka00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GK0282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gka03029]
    GK0282
Enzymes [BR:gka01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GK0282
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GK0282
Mitochondrial biogenesis [BR:gka03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GK0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAD74567
UniProt: Q5L3B3
LinkDB All DBs
Position
308741..310198
Genome map
AA seq 485 aa AA seqDB search
MSLFDHSVSELHTLLKKKEVSISDLVDESYRRIDEVEEKVQAFLTLNEEQARAKAKELDN
QLAKGEETNPLFGLPIGIKDNIVTKGLRTTCASKILYNFDPIYDATVMERLNAAGTITIG
KLNMDEFAMGSSTENSGFQLTRNPWDLERVPGGSSGGSAAAVAAGEVPFALGSDTGGSIR
QPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRTVEDNAYVLQAIAGVDPMDSTS
ANIPVPNYVEALTGDIKGLKIAVPKEYLGEGVDEGVRQSVLAALAVLEKLGAAWEEVSLP
HSKYALATYYLLASSEASANLARFDGVRYGYRTDNAKNLIDMYKLTRSEGFGAEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKRDFENVFERYDVIIGPTTPTPAFKIGEKTSDPLT
MYMNDILTIPVNLAGVPAISVPCGFVDGLPVGLQIIGKHFDESTVYRVAHAFEQATDYHK
QKPVL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttttgaccattccgtgtcagaattacatacgttgctgaagaaaaaagaagtg
tcgatttccgatttagtcgacgaatcgtaccgccgcatcgatgaagtggaagagaaagtg
caagcgtttttaacattaaatgaagaacaggcgcgggcgaaagcgaaagagttggataac
cagctcgccaaaggcgaagaaacgaacccgctgttcggcttgccgatcggcattaaagac
aacatcgtcacaaaagggctgcgtacgacatgcgccagcaaaattttgtacaactttgac
ccgatttacgacgccactgtcatggagcggttgaatgccgcagggacgatcacgatcggg
aagttgaacatggacgagttcgccatgggctcgtcgacggaaaactccgggtttcagctg
acgcgcaacccgtgggacttagagcgcgttccgggcggctcgagcggcggttcggcggcg
gcggtggcggccggcgaagtgccgtttgctttaggttctgatacgggcggttcgatccgc
cagccggcagcgttttgcggggttgttggcttgaagccgacgtacggacgcgtctcgcgc
tttggcctcgtcgcgtttgcctcgtcgcttgaccaaatcggcccgattacgcgcacggtc
gaagacaacgcgtatgtattgcaagcgatcgcgggcgtcgacccgatggattcgacttca
gcgaacattccagtgccgaactatgtggaggcgttaacgggcgatatcaaagggttgaaa
atcgctgtgccgaaagaatatttaggtgaaggcgtcgatgaaggcgtgcgccagtcagtg
cttgcggcgcttgccgtgcttgagaagcttggcgcggcgtgggaagaagtgtcgctgccg
cattcaaaatacgccttggcgacgtactatttgctcgcttcgtccgaggcatcagcgaac
ttggctcgctttgacggcgtccgctacggctatcggacggacaacgcgaaaaacttgatc
gatatgtataaactgacgcgaagcgaagggtttggggcggaggtcaagcgccgcattatg
ctcgggacgttcgcgttaagctcgggctattacgatgcgtattacaaaaaagcgcaaaaa
gttcggacgttgatcaagcgcgacttcgaaaacgtatttgaacgatatgacgtcatcatc
ggcccgacaacgccgacgccggcgtttaaaatcggcgagaaaacgagtgatccgctgacg
atgtacatgaacgacattttaacgattccagtcaaccttgcgggtgtaccggcgatttct
gtgccgtgcggctttgttgatggcttgccggtcggcttgcaaattatcggcaagcacttt
gatgaaagcaccgtctaccgcgtcgcccacgcttttgaacaagcgaccgactaccataag
caaaaaccggtgttgtaa

DBGET integrated database retrieval system