KEGG   Geobacillus kaustophilus: GK1411Help
Entry
GK1411            CDS       T00217                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GK1411
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GK1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: BAD75696
UniProt: Q5L040
LinkDB All DBs
Position
1443024..1444490
Genome map
AA seq 488 aa AA seqDB search
MKMGTEKQTYLNYINGEWIHSSTGKIEASLNPANIDDIVGYVQESGVEDVNVAVEAARRA
QAAWRKLSGPKRGEYLFRAADVLEKRLDEIAETMTREMGKTLPEAKGEVQRGVNILRYYA
GEGMRSIGEVIPSMDSEALMFTTRVPLGVVGVITPWNFPVAIPIWKIAPAIVYGNTVVFK
PAQETAVTAAKIVECFDQAGLPAGVVNLVTGKGSVIGNAIAEHPHIHGITFTGSNEVGKT
IAQKAVARGAKYQLEMGGKNPVIVLEDADLDRAVEATISGGLRSTGQKCTATSRVFVQSS
IYESFKEQLLAKIKQLKIGDGLKEGVWMGPCASRKQLETILSYIEKGIEEGATLLCGGRR
LVDGELGNGFYIEPTVFENVSPNMTIAREEIFGPVLSLIKVDTFEEALALANDTPFGLSA
SIFTQNIGKMLAFIQDIEAGLVRINEESAGVELQAPFGGMKQSSSHSREQGRAAIEFFTA
IKTVFVKG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggaacagaaaaacaaacatacttgaattacatcaatggcgaatggattcat
tcctccactggaaaaatcgaagccagccttaacccagccaacatcgatgatatcgtcggc
tacgttcaagagtccggagtcgaggatgtgaacgttgcggttgaggcggcgcgaagggcg
caggcggcatggcggaagctgtccggcccgaaacgcggagagtatttgttccgcgcggct
gacgttcttgagaaacggcttgacgagatcgccgaaacgatgacaagagaaatgggaaaa
acgctcccggaagcaaaaggggaagtgcagcggggagtcaatattttgcgctactatgct
ggggaggggatgcggtccatcggcgaggtcattccatccatggacagcgaagcgttgatg
tttaccacgcgcgtgcctcttggcgtggttggggtcatcacgccgtggaactttccagtc
gcgattccgatttggaaaatcgcacccgccatcgtctatggaaacaccgttgtgtttaag
ccggcgcaagaaacagctgtcaccgccgcgaaaatcgtggagtgctttgatcaagcgggg
ctgccggccggcgttgtgaatttggtgacgggcaaaggatcggtcatcggcaatgcgatc
gccgaacacccccatattcacggcatcaccttcaccggctccaatgaagtcggcaaaacg
atcgcccaaaaagcggtggcccgaggggcgaaataccagctggaaatgggcggaaagaat
ccggtgatcgtgctcgaggacgctgaccttgatcgcgccgtcgaagcgacgattagcgga
ggactgcgttcgacggggcaaaaatgtacggcgacaagccgtgtcttcgttcagagttcc
atctatgaatcgtttaaagaacaattattagcgaagattaaacagttgaaaattggcgac
ggactgaaagaaggcgtctggatgggcccgtgcgccagccggaagcagttggagacgatt
ctttcttatatcgaaaaagggatcgaagaaggggcgacattgctttgcggcggccgccgc
ttggtcgatggagagctcggaaacgggttttatatagagccgacggtgtttgagaacgta
tccccgaacatgacgatcgctcgcgaggaaattttcgggccggtgctctccttaattaaa
gtggacacgtttgaagaagcgttagccttagccaatgacacaccgtttggccttagcgcc
tcgattttcacgcaaaatatcggcaagatgctcgcgttcatccaagacatcgaggccggg
ctcgtccggattaatgaagaaagcgcaggagtcgaactgcaagcgccgtttggcgggatg
aagcagtccagctcccactcacgggaacaagggcgggcggccatcgagttttttacggcg
attaaaacggtgtttgtaaaaggataa

DBGET integrated database retrieval system