KEGG   Geobacillus kaustophilus: GK2100Help
Entry
GK2100            CDS       T00217                                 

Definition
(GenBank) hypothetical conserved protein
Organism
gka  Geobacillus kaustophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-ProteinID: BAD76385
UniProt: Q5KY51
LinkDB All DBs
Position
2141337..2142125
Genome map
AA seq 262 aa AA seqDB search
MSDRRPIRVKCLSPLCGTWPPIVKIYTGPTGPTGPTGPTGPTGPQGPTGPIGPQGPTGPQ
GPTGPTGPTGPQGPTGPTGPTGPQGPTGPTGPAGAGAIIPFASGTTVVLTATIAGLADTT
SLIGFGNAASSISLVGGTINLGGTSNFSFTIPRSGIITAVAANFSATTGTALLGTATIRA
QLYIATSPSSNVFSPIPGTLITLTPSITFPISLAQNASGIITGLNVPVNAGDRLLMAFFI
TTSGLSIAASVTGYASAGVAIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgaccgacgtcctattcgagtaaaatgtctttcccctttatgcggaacatggccg
ccgattgtaaaaatctataccggaccaacaggacccacgggacccacagggcctacagga
ccgactggacctcaaggacccacgggacccatcggacctcaaggacccacaggacctcaa
ggacctacagggccgaccggacccacaggacctcaaggacctacagggccgactggaccc
acaggacctcaaggacccacagggccgacgggaccggctggagcaggagccatcattcca
ttcgcttcaggaacaacggttgtcttgaccgccactatagccgggttggccgacaccaca
agtttgatcggatttggaaacgctgcttcaagcatcagtttagtgggaggaacgataaac
cttggcggcacatcgaatttttcctttaccatcccgcgttcaggaatcattactgctgtc
gcagccaatttttccgctacaacaggcacagcgcttttaggaacagctacgatccgcgct
caattgtatatcgccacttctccatccagcaacgtattttcgcctattccaggcacgctc
attacattaacgccatcaatcacctttcccatctccctagcccaaaacgccagcggcatc
atcacaggattaaacgtgcctgtcaatgctggcgaccggctgctcatggcgtttttcatc
accacttccggcctttcaatcgccgcttccgtcacgggatatgcgagcgcaggagtggcg
attagttag

DBGET integrated database retrieval system