KEGG   Geobacillus kaustophilus: GK2162Help
Entry
GK2162            CDS       T00217                                 

Definition
(GenBank) hypothetical conserved protein
Organism
gka  Geobacillus kaustophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YppG CAP_N
Motif
Other DBs
NCBI-ProteinID: BAD76447
UniProt: Q5KXY9
LinkDB All DBs
Position
complement(2208492..2208839)
Genome map
AA seq 115 aa AA seqDB search
MHRYSRPVLPPPTYGPYGLGSHYHPYFHYGGSSFPSAPGHWPFFPSTHAAPPPHPASYPK
PGPLLPPPRPSFLAQFKNSDGTYDINKMMSTVGQMINTVNQVNGVLKGLLGTFKK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgttactcgcgcccggttttaccaccgcccacgtatggtccctatggcttaggc
agccattatcatccttacttccactatggaggttcatcttttccatcggcgccggggcac
tggcccttttttccgtccacccatgccgccccgcctccccatccggcgtcatacccaaag
ccggggccgcttttgccgccgccgcgcccgtcgtttctcgcccagtttaaaaacagcgac
ggaacgtacgatatcaacaaaatgatgagtaccgtggggcaaatgatcaatacggtcaat
caagtgaatggcgtgttgaaaggattgctcggtacgtttaaaaaatga

DBGET integrated database retrieval system