KEGG   Geobacillus kaustophilus: GK2168Help
Entry
GK2168            CDS       T00217                                 

Definition
(GenBank) penicillin-binding protein 1A/1B (PBP1) (penicillin-insensitive transglycosylase (peptidoglycan TGase); penicillin-sensitive transpeptidase (DD-transpeptidase))
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00550  Peptidoglycan biosynthesis
gka01100  Metabolic pathways
gka01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GK2168
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    GK2168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gka01003]
    GK2168
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
    GK2168
Enzymes [BR:gka01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     GK2168
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GK2168
Glycosyltransferases [BR:gka01003]
 Polysaccharide
  Bacterial polysaccharide
   GK2168
Peptidoglycan biosynthesis and degradation proteins [BR:gka01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   GK2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase fn3 TDA11 Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: BAD76453
UniProt: Q5KXY3
LinkDB All DBs
Position
2211300..2213990
Genome map
AA seq 896 aa AA seqDB search
MSGEYRSRVERKQAAKQTKQKKAKTKRGRSWLKTIAIAILLMMVLGAIGGIATFAYFVKD
APPLDEAKIKDPLSSVLYDMNGKQVAELGGYKRTYISYKDVPKVLEDAVLATEDARFYEH
HGIDVVRLAGAVLANIKEGFGAEGGSTITQQVVKMTFLSSEKTLKRKAQEAWLALQLEQK
YSKHEILEMYLNKIYYSDGIYGVARAAEYYFGKTDLKKLTLPEAALLAGMPQSPNRYNPY
DHPEAAKKRRDTVLSLMAKHGFISQEEAEKAKQVPIQSMLAERKKSQSSVPYDAFIDEVI
KEVTDKANVNVFEDGLKIYTTLDQNVQTYVEKLLNSDKYFTNKKDLQSGIAVVDTKTGAI
RALGGGRHRDNIEFGFNYAIQPVGQPGSTIKPILDYGPAIEYLKWSTAHILVDEPYTYSD
GTPIRNAGGKYAGPVTLRKALTWSYNIPALKTYQAVGKERAMEFANRLGMGFDEVYEPYA
IGGVSRYVSVLQMAGAYTAFGNNGVYTKPYAVTKIVFPDGTEMDLQPKPKRVMHDYTAYM
ITDVLKSVIRSGTGQLANVPGLELAGKTGTTNYGKDGAKFGLDRDDVPDSWIVGYTPNYT
AAIWVGFSKRSSTAKLDKYEQKIPKYLLRDIMSHIDDGSGEFKQPDSVVKLPIKKGTNPP
KLAGKYTPESEITYELFVRGTEPTETANDVPEELPAVKGLTAVYDQAANAISVSWSYDEQ
TDETIFEVRVKDGQGQTNTITTKDRSITISNPTPGWTYTIAVYAKDGERMSKPAIASVHV
PGGEDQTPVPQQPGDDSQGSGGQNGGTDQGNSGNNGNENGQGNNNEQNGGASGGQENGNS
GGANQNNGQTDGTNNQGTNNSGQTNGTNGGTGANSGTPPVSPPLKNGSGAGLGTRP
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtgaatatcgttctcgcgtagaacgaaagcaggcagcgaaacaaacgaaacag
aagaaagcgaaaacgaaacgaggaagatcgtggttaaaaaccatcgccattgcgatattg
ctgatgatggtccttggcgccatcgggggtattgccactttcgcctatttcgttaaggac
gctcctccgctggatgaggccaaaattaaagatccgctttcttccgtcttgtacgatatg
aatggaaaacaagtagcggagcttggcggctacaagcgaacgtacatttcgtataaagac
gtgccgaaagtgcttgaagatgccgtcttggcaacagaggacgcccgcttttatgaacac
cacggcatcgatgtcgtccgcttggctggcgccgtcctcgccaacatcaaggaaggattt
ggtgcagaaggcggcagcacgatcacccagcaagtcgtcaaaatgacgtttttgtcgtca
gaaaaaacgttgaagcgaaaagcgcaagaggcatggctcgcgctgcagcttgaacaaaaa
tattcgaagcatgaaattttggaaatgtatttgaacaaaatttattattcagacggcatt
tatggcgtcgctcgcgccgccgaatattattttggcaagacagacttgaaaaagctcact
cttccggaagcggccttgctcgccggcatgccgcaaagtccaaaccggtataatccgtat
gaccatccagaggcggcgaaaaaacggcgcgataccgtattgtcgctcatggcgaaacat
ggctttatcagccaggaagaagcggaaaaagcgaaacaagtgccgatccagtcgatgctc
gctgagcggaaaaaatcgcaaagctccgtgccgtatgacgccttcattgacgaagtaatc
aaagaagtgaccgacaaagcgaacgtcaacgtctttgaagatgggctgaaaatttataca
acgctcgatcaaaacgttcaaacatacgtagaaaagctattaaactctgacaaatacttt
accaataagaaggatttgcaatccggcatcgccgtcgtcgacaccaaaacaggcgccatt
cgcgcgttaggcggcggtcgccatcgcgacaatatcgaattcggcttcaactacgcaatc
caaccggtcggccagcccggttcaacgatcaagccgattttggactatggcccggcgatt
gaatatttaaaatggtcaacagcgcacattcttgttgacgagccgtatacgtattcggac
ggcacgccgatccgcaacgccggcggaaaatacgctgggccggtgacattgcgcaaagct
ctcacgtggtcatacaacattccggcgctcaaaacctatcaagccgtcggcaaagagcgg
gcgatggagttcgctaaccgactcggcatgggctttgatgaagtatatgagccttacgct
atcggcggagtatcccgctacgtatcggtgctgcaaatggctggagcgtacactgctttt
ggtaataacggcgtctatacgaagccatatgccgtgacaaaaatcgtcttcccggacggc
acggaaatggatttgcaacccaaaccaaaacgagtgatgcacgactataccgcctacatg
atcacggacgtgctgaagtctgtcatccgctccggaacaggtcaattggccaatgttcca
ggacttgagctcgcaggcaaaacagggacgacgaactatgggaaagatggagcaaaattc
ggccttgaccgggacgatgtgccggacagctggattgtcggctatacgccaaactatacg
gcggccatttgggtcggcttcagcaagcgaagcagcacggcaaagcttgataaatatgag
cagaaaatcccgaaatatttgctcagagacatcatgtcccacatcgatgacggtagtggg
gaattcaaacagccggacagcgtcgtcaagctgccgatcaaaaaaggcacaaacccgccg
aagctcgccggcaaatacacgccggaaagcgaaattacgtatgaattgttcgtgcgcggc
actgagccgacggagacggcgaacgacgtgccggaagaactgccggcggtgaaagggttg
accgctgtgtacgaccaagcggcgaacgccatctcggtttcgtggtcatacgatgagcaa
accgatgagacgatcttcgaggtgcgcgtcaaagatggccaaggtcaaacgaatacgatc
accacaaaagaccgttcgatcacgatttccaatccgacgccaggatggacgtacacaatc
gccgtgtacgcaaaagacggcgaacgaatgagcaaaccggccatagccagcgttcatgtc
cccggcggagaagatcaaactcccgtgccacaacaaccgggggatgacagccaaggcagc
ggcgggcaaaacggcggcaccgatcaaggcaacagcgggaataacggaaacgaaaacggt
cagggaaacaacaatgaacaaaacggcggcgcaagcggcggacaagaaaatggcaacagc
ggcggggccaaccaaaacaatggccaaacggatggaacaaacaaccaaggaacgaacaac
agcggccaaacgaacggaacgaacggtggaacgggtgcaaacagcggaacgccgcctgtc
tccccgccgttaaaaaacggatccggagcgggtcttggcacccgtccataa

DBGET integrated database retrieval system