KEGG   Geobacillus kaustophilus: GK2423Help
Entry
GK2423            CDS       T00217                                 

Definition
(GenBank) glycine cleavage system P-protein, glycine dehydrogenase [decarboxylating] subunit 2 (glycine decarboxylase)
  KO
K00283  glycine dehydrogenase subunit 2 [EC:1.4.4.2]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00260  Glycine, serine and threonine metabolism
gka00630  Glyoxylate and dicarboxylate metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01130  Biosynthesis of antibiotics
gka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GK2423
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GK2423
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     GK2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAD76708
UniProt: Q5KX78
LinkDB All DBs
Position
complement(2452128..2453624)
Genome map
AA seq 498 aa AA seqDB search
MSMNWGMAMHNDQPLIFERSKPGRIAYSLPALDVPAVDVSELVPADYLRTEEPELPEVSE
LDLMRHYTALSKRNHGVDSGFYPLGSCTMKYNPKINENVARLAGFAHIHPLQPEKTVQGA
LELMYDLQEHLKEITGMDAVTLQPAAGAHGEWTGLMMIRAYHEANGDFNRTKVIVPDSAH
GTNPASATVAGFETVTVKSTADGLVDLEDLKRVVGPDTAALMLTNPNTLGLFEEQIVEVA
EIVHAAGGKLYYDGANLNAILGKARPGDMGFDVVHLNLHKTFTGPHGGGGPGSGPVGVKA
DLVPFLPKPVIEKGENGYYLDDDRPQSIGRVKPFYGNFGINVRAYTYIRSMGPDGLKAVS
EYAVLNANYMMRRLADYYDLPYDRHCKHEFVLSGRRQKKLGVRTLDIAKRLLDFGFHPPT
IYFPLIVEECMMIEPTETESKETLDAFIDAMIQIAKEAEENPEIVQEAPHTTVVKRLDET
TAARKPILRYQKPKHSDN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaatgaattgggggatggccatgcataacgatcaaccgcttattttcgaacgaagc
aagccggggcgcatcgcctacagcctgccagcgcttgacgtgccggctgtcgatgtcagc
gagctcgtgccggccgattatcttcgcactgaagagccggagctcccggaagtgtcggag
cttgacttaatgcgccattatacggcgctctcgaaacgaaaccacggcgtcgattccggt
ttttacccgctcgggtcgtgcacgatgaaatacaatccgaaaatcaatgaaaacgtcgcc
cgcctcgccgggtttgcccacattcatccgcttcagccagagaaaacggtgcaaggggct
cttgagttgatgtacgacttgcaagagcatttaaaagaaatcacgggcatggatgcggtc
accttgcagccggcggccggcgcccacggcgagtggaccgggctgatgatgatccgcgct
taccatgaagcaaacggcgacttcaaccggacgaaagtgatcgtcccggattcagcgcac
gggacgaacccggcgtcggcaacggtcgccggttttgagacggtgacggtcaaatcgacc
gccgatggacttgttgatttagaggacttaaagcgcgtcgtcggtccggatacagcggcg
cttatgctcacgaatccgaatacgctcgggctgtttgaagagcagatcgtcgaagtggct
gaaatcgtccacgcagccggcggcaagctgtattatgacggggcgaatttaaacgccatt
cttggcaaggcgcgcccgggggacatgggctttgacgtcgttcatttgaacttgcataaa
acgttcaccggcccgcacggcggcggaggcccaggctcaggcccggtcggggtgaaagcc
gacctcgttccgtttttgccgaagccggtcatcgaaaaaggagaaaacggctattatctc
gatgacgaccgcccgcagtcgatcggccgcgtcaagccgttttacggcaatttcggcatc
aacgtccgggcgtacacgtacatccgctcgatggggccggacggcttaaaagcggtgagc
gagtacgccgtgttaaacgccaactatatgatgcggaggcttgccgactattacgatttg
ccgtacgaccgccattgcaagcacgagttcgtcctgtcgggacgccggcaaaagaaactc
ggcgtcagaacgctcgacatcgccaaacggctgcttgatttcggcttccatccgccgacg
atttacttcccgctcatcgtcgaagagtgcatgatgattgagccgacggagacggagtcg
aaagagacgcttgacgcgtttattgacgccatgatccaaattgccaaagaggcggaggaa
aatccggaaatcgttcaagaagcgccgcatacgaccgttgtgaagcgacttgatgaaacg
accgcagcgcgcaagccgattttgcgctatcaaaaaccaaaacatagcgacaactga

DBGET integrated database retrieval system