KEGG   Geobacillus kaustophilus: GK2574Help
Entry
GK2574            CDS       T00217                                 

Definition
(GenBank) NADH-peroxiredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gka  Geobacillus kaustophilus
Brite
KEGG Orthology (KO) [BR:gka00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GK2574
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GK2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C Thioredoxin_4 NAD_binding_7 FAD_binding_3 Glutaredoxin Thi4 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAD76859
UniProt: Q5KWS7
LinkDB All DBs
Position
complement(2589378..2590907)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSSKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHF
ETYVSLTCHNCPDVVQALNIMSVLNPDISHTMIDGAAFKEEAEQKGIMAVPTVFLNGKLF
ASGRMSLEDILAKLGSAPDASSFADKEPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYNVDIMNSQRAKRLEKKDLIEVELE
NGAVLKSKTVVIATGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTVIKNAQTTEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNIEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggatgctgacatcaaggcgcaactagcccagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgtcgaaaatcaaagtcgaaaaagcgaagctggaacga
acgccaagcttcagcgtcaaccgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgttgcttcaagtgagcgggcggccg
ccgaaagtcagccaagacgtcgtggaccgcattcaacaaatcagaggcaaacatcatttt
gaaacgtacgtcagcctgacctgccacaactgcccggacgtcgtccaagcgctcaacatc
atgagcgtgttgaacccagacatttcgcatacgatgatcgacggggcggcgtttaaagaa
gaagcggagcaaaaagggattatggccgtaccgacggtgtttttaaacggcaaactgttc
gcgagcggccgcatgtcgcttgaagatatcctcgccaaattagggagtgctccggatgct
tcttcctttgctgacaaagagccgttcgacgtgttggtgatcggcggcggccctgcgggt
gcgacagcagccatttacgcagcgcgcaaaggcattcgcactgggattgttgcggagcgc
ttcggtggacaaattttagatacgctcggcattgaaaactttatcagcgtcaaatatacg
gaaggaccgaagcttgcggccagcattgaggaacatgtgaagcaatacaacgtcgacatc
atgaactcgcagcgggcaaaacgactcgagaaaaaagacttgattgaagtcgagttggaa
aacggcgccgtgttgaaaagcaaaacggttgtgatcgcaacgggcgcccgttggcgcaac
cttggcgtgccgggcgaggaagagttcaaaaacaaaggggtcgcctattgcccgcattgc
gacggcccgctgttcgaagggaagcacgtggcggtcatcggcggcgggaactctggagtc
gaagcggcgattgacctcgctggcatcgccagccatgtgacgctgcttgagttcgcccct
gaactcaaggccgatgctgttttgcaagatcgtttgtacagcttgccgaacgtaacggtg
attaaaaacgcgcaaacgacggaaatcaccggcacggacaaagtcaacggcttgacgtac
attgaccgggaaacaggggaagaacatcatatcgaattgcaaggcgtgttcgtgcaaatc
ggccttgttccgaacaccgaatggttggaaggaacggtggaacggaatcgcttcggtgaa
attatcgtcgataaacgcggcgcgacgaacattgaaggcgtctttgccgcgggcgactgc
acggacagcgcctataagcaaatcattatttcgatgggctcgggtgcaaccgcagcgtta
agcgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system