KEGG   Geobacillus kaustophilus: GK2578Help
Entry
GK2578            CDS       T00217                                 

Definition
(GenBank) GTP pyrophosphokinase (ppGpp synthetase)
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00230  Purine metabolism
gka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GK2578
Enzymes [BR:gka01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     GK2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 HD ACT DUF1444 ThiS Ub-Mut7C DUF493 DUF668
Motif
Other DBs
NCBI-ProteinID: BAD76863
UniProt: Q5KWS3
LinkDB All DBs
Position
complement(2592456..2594654)
Genome map
AA seq 732 aa AA seqDB search
MANEQVLTAEQVFERASCYLSEQDVAFLKKAYEFAKHAHRDQFRKSGEPYIIHPIQVAGI
LVDLKMDATTIAAGFLHDVIEDTEATKEDLEREFGAEVAMLVDGVTKLGKIKYKSQEEQQ
AENHRKMFLAMAQDIRVILIKLADRLHNMRTLKHLPAEKQRRIANETLEIFAPLAHRLGI
SKIKWELEDTALRYLNPQQYYRIVNLMKKKRAEREQYLEEVIQEVRERLNEVHIPCEISG
RPKHIYSIYRKMVMQNKQFNEIYDLLAVRIIVNSIKDCYAVLGIIHTCWKPMPGRFKDYI
AMPKPNMYQSLHTTVIGPKGEPLEVQIRTFEMHQIAEFGIAAHWAYKEGKTIKPNSFEEK
LSWFREILEWQNDASNAEEFMESLKMDLFSDMVFVFTPKGDVIELPAGSVPIDFAYRIHS
EIGNKTIGAKVNGKMVPLDYKLQTGDIVEILTSNHSYGPSQDWLKLAKTSQARNKIRQFF
KKQRREENIEKGKEMVEKEVRSLGFEPKEVMTADNVKRVAEKFNFSNEDDMYAAVGYHGI
TAAQIAHRLTEKWRKQRDLEEQQRKLAEAVFEAKLPAGKKRDCGIRVQGMDNLLIRLSRC
CNPVPGDEIIGFITRGRGISVHRADCPNVKTEEAADRLIAVEWESGANGEREYNVDIEIT
GFDRRGLLNEVLQAVNETRTDISAVSGRSDHRHKIATIHMTIAIHNLSHLQKVVERIKQI
PDIYSVQRLMNN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgaacaagtgctgacagcggagcaagtgtttgaacgagcgagctgctatttg
tcggaacaagacgtcgcctttttgaaaaaggcgtatgagtttgccaagcacgcccatcgc
gaccaatttcggaaatcgggcgaaccatacatcatccacccgattcaagtcgcgggcatt
ttggtggacttaaagatggacgcgacaacgatcgccgccgggtttttgcatgatgtcatc
gaagacactgaggcgacaaaagaagacctcgagcgcgagttcggcgcggaagtggcgatg
cttgtcgacggggtgacgaagcttgggaaaattaaatataaatcgcaggaagaacagcag
gcggaaaaccaccggaaaatgtttttggccatggcgcaagatatccgggtcattttgatc
aagctcgccgaccggctgcacaatatgcggacattgaaacatttgccggccgaaaaacag
cggcgcattgccaatgagacgctcgaaattttcgctccgctcgcgcatcggctcggcatt
tcgaaaatcaaatgggagcttgaggatacggcgcttcgctatttaaacccgcagcaatat
taccgcatcgtcaatttaatgaagaaaaagcgggctgagcgcgagcaatatttggaggaa
gtcattcaagaagtgcgcgaacggctcaacgaagtgcatattccttgcgaaatttccggg
cgtccgaaacatatttacagcatttatcgaaaaatggtgatgcaaaataaacagttcaac
gaaatttacgatttgctcgctgtccgcatcatcgtcaacagcatcaaagactgctatgct
gtgctcggcattattcatacatgctggaagccaatgccaggccgcttcaaagactacatc
gccatgccgaagccgaacatgtaccaatcgctccatacgacggtgatcggcccaaaaggc
gaaccgcttgaggtgcaaatccgcacgtttgaaatgcatcaaatcgccgagttcgggatt
gctgcccactgggcgtacaaagaaggaaagacgatcaaacccaactcgtttgaagaaaag
ctgtcttggtttcgggaaattttggaatggcaaaacgacgccagcaatgccgaagagttc
atggaatcgctcaagatggatttgttttccgacatggtgttcgtcttcacgccaaaaggc
gatgtcatcgagctgccggccggatcggtgccaatcgatttcgcttaccgcatccattcg
gaaatcggcaacaagacgatcggggcgaaagtcaacggcaaaatggtgccgcttgactac
aagctgcaaacgggcgacatcgtcgaaattttaacttccaatcattcgtacggtccgagc
caagactggctgaaactggcgaaaacgtcgcaggcgcgcaacaaaatccgccagtttttc
aaaaagcaacggcgcgaagaaaacatcgaaaaaggcaaagagatggtcgaaaaagaggtg
cgcagcctcggctttgagccgaaagaagtgatgacggccgacaacgtaaagcgcgtcgcc
gaaaagttcaacttctcgaacgaagacgatatgtatgcggcagtcggctatcatggcatc
acagcggcgcaaatcgcccatcggttgacggaaaaatggcgaaagcagcgcgatctcgag
gaacagcagcgcaaactggccgaagcggtcttcgaagccaagctgccagctggcaaaaag
cgcgactgcggcattcgcgtccaaggaatggacaacttgctcatccgtttgtcgcgctgc
tgcaacccggtgccgggcgatgaaattatcggcttcattacccgcggccgcggcatttcc
gtccaccgcgccgattgcccgaacgtcaagaccgaagaagcggccgatcggttgattgcc
gtagaatgggagagcggagcaaacggcgagcgtgaatataacgtggacattgagatcacc
ggatttgaccgccgcggtttgctgaatgaggtgctgcaggcggtgaatgaaacgcgcacc
gatatttccgccgtctcgggacgctcagaccaccgacataaaattgcgacgatccatatg
acaatcgccattcataatttgagccacttgcaaaaagtcgtcgaacgaatcaaacaaatt
cccgacatttattccgtccagcgcttgatgaacaactaa

DBGET integrated database retrieval system