KEGG   Geobacillus kaustophilus: GK3008Help
Entry
GK3008            CDS       T00217                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00071  Fatty acid degradation
gka00362  Benzoate degradation
gka00650  Butanoate metabolism
gka01100  Metabolic pathways
gka01120  Microbial metabolism in diverse environments
gka01200  Carbon metabolism
gka01212  Fatty acid metabolism
Module
gka_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GK3008
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GK3008
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GK3008
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GK3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAD77293
UniProt: Q5KVJ3
LinkDB All DBs
Position
complement(3031208..3033595)
Genome map
AA seq 795 aa AA seqDB search
MVKRIRRAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPRELTKEEEAKGWTLEHKQVRNR
LANQALERLLKQKPAPLMSKDNIALIETGNFEDDFHRLAEVDWIIEAVVEKLEVKKEVFA
RVDEVRTPGTIVSSNTSGISIAAMAEGRSDDFKKHFLGTHFFNPPRYLKLLEIIPTEHTD
PDVVAYMKSFGEDVLGKGVVMAKDTPNFIANRIGTYGLLVTVREMMQGGYSVGEVDSVTG
PLIGRPKSATFRTLDVVGLDTFVHVANNVYENVEGEEKEAFRVPEFMKTMLENGWLGSKS
GQGFFVKQGKDILELNYVTMQYEPRKKLVTPAVEMAKQAKGAAAKLQTLVYADGDRAGTL
LWNIIAPTLLYTARLVGEIADDIAAIDQAMKWGFGWEQGPFELWDAIGLEKSVRKMQSEG
RDIPSWITDMLADGATSFYKTENGRLFYYAPGGYKTVEENEKVIHIRRLKEARGVIKKNA
GASLIDLGDDVALLEFHSPNNAIGADIVQMINEALEEVNRNYKGLVIGNQGKNFCVGANL
AMMLMEAQDENFFELELAVRQFQQALLKMKYNPKPVVVAPFAMTLGGGAEVSLAASRIQA
AAETYIGLVEVGVGLIPGGGGNKELYIKRLNSLPRGVDVDYVKIAASVFETIAMAKVSTS
AAEARELGFLNHRDGITMNGDHLLYEAKQAVLSMYEEGYRPPVRKKVPVAGESGYAAMLL
GAQSMFHSGYISEHDLKIAKKLAYVLAGGKVPYGTEVDEQYLLDLEREAFLSLIGEPKTQ
ARMQHMLVKGKPLRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacgcattcggcgcgccgcggtgctcgggtccggcgtcatgggttcgggcatt
gccgcccatttggcgaacgtcggcattccgacgctgctgttggatatcgtgccgcgggaa
ttgacgaaagaggaagaagcaaaaggttggacgctcgagcataaacaagtgcgcaaccgc
ctcgccaatcaggcgctcgagcggctgctcaagcaaaaaccggcgccgctcatgtccaaa
gacaacatcgctttgattgaaacgggcaacttcgaggatgacttccaccggctcgcggaa
gtcgattggatcattgaagcggtcgttgaaaagctggaagtgaaaaaagaagtcttcgct
cgcgtcgacgaggtgcggacgccggggacgatcgtcagctcgaacacatccggcatctcg
atcgccgcaatggcggaggggcgttccgacgatttcaaaaaacactttttaggcacgcat
ttcttcaacccgccgcgctatttgaagctgcttgagatcatcccgacggagcatacggat
ccggatgtggtcgcctatatgaaatcgttcggcgaagacgtgctcggcaaaggcgtcgtc
atggcgaaagatacgccgaacttcatcgccaaccggatcggcacgtatggcttgctcgtc
accgtccgcgagatgatgcaaggcggctacagcgtcggcgaggtcgattcggtgacgggg
ccgctcatcggccggccgaaaagcgcgacgttccgcacgcttgacgtcgtcgggctcgat
acgttcgtgcatgtcgccaacaacgtgtatgaaaacgtcgaaggggaagaaaaagaggcg
ttccgcgtgccggagtttatgaaaacgatgcttgaaaacggctggctcggcagcaaatcc
ggacaaggcttttttgtcaagcaaggaaaagacattctcgagctgaactacgtcacgatg
caatacgagccgcgcaaaaagcttgtcaccccggcggtggagatggcgaagcaggcgaaa
ggagcggctgccaagctgcaaacgctcgtgtatgccgatggcgaccgcgcgggaacgctc
ctttggaacatcatcgcaccgacattgctgtacactgcccgccttgtcggggagatcgcc
gacgacatcgcagcgatcgatcaggcgatgaagtgggggtttggctgggagcaaggtccg
tttgaactgtgggacgcgatcggcctcgagaagtcggtgcgtaaaatgcagtcagaaggg
cgcgacatcccgtcgtggatcacggacatgctcgccgacggagccacatcgttctataaa
acggaaaacggccggctgttctattatgcgccgggcgggtataaaacagtagaagaaaac
gaaaaagtcatccacatccgccggctgaaagaggcgcgcggcgtcatcaagaaaaatgcc
ggcgccagcctcattgacctcggcgacgacgtggcgcttctggagttccattcgccgaac
aacgcgattggcgccgatattgtccaaatgatcaacgaggcgcttgaggaagtcaaccgc
aactacaaagggctcgtcatcggcaaccaagggaaaaacttctgcgtcggcgcgaacttg
gcgatgatgctcatggaggcgcaagacgaaaacttttttgaattggaacttgccgttcgc
cagttccagcaagcgcttctcaaaatgaaatacaacccgaagccggtcgtcgtcgcgccg
tttgccatgacgttaggcggcggggcggaagtgagcttggcggcttcacgcatccaagcg
gcggccgagacgtacatcgggctcgtcgaagtcggcgtcggcttgattccgggcggcggc
ggcaacaaggagctgtacatcaaacggttgaacagcctgccgcgcggcgtggacgtcgac
tacgtcaaaatcgcggccagcgtatttgaaacgatcgccatggcgaaagtgtcgacgtca
gcggcggaagcgcgcgagcttggcttcttgaatcaccgcgacggcatcacgatgaacggc
gaccatctgctgtatgaagcgaaacaggcggtgctctcgatgtatgaggaagggtaccgg
cctcctgtaaggaagaaagtgccggtggccggcgaaagcggctatgccgccatgctgctt
ggggcgcagtcgatgttccattccggctacatcagcgagcacgatttgaaaatcgcgaaa
aaattggcgtatgttctagccggcggcaaagtgccgtacggaacggaagtcgacgagcaa
tatttgctcgatctcgagcgcgaggcgtttttgagcctcatcggcgagccgaagacgcaa
gcgcgcatgcagcatatgcttgtgaaaggaaaaccgctccgcaactaa

DBGET integrated database retrieval system