KEGG   Geobacillus kaustophilus: GK3070Help
Entry
GK3070            CDS       T00217                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase;phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00340  Histidine metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01230  Biosynthesis of amino acids
Module
gka_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    GK3070
Enzymes [BR:gka01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     GK3070
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     GK3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3239
Motif
Other DBs
NCBI-ProteinID: BAD77355
UniProt: Q5KVD1
LinkDB All DBs
Position
complement(3091042..3091689)
Genome map
AA seq 215 aa AA seqDB search
MTADIRFDEKGLVPAIVQDAQSKEVLTLAYMNKESLKKTLETGETWFYSRSRQELWHKGA
TSGNVQRVVDIRYDCDADALLVLVEPAGPACHTGSYSCFSRSLDGAARTPAADRFAILHE
LEQIIAQRDAERPEGSYTTYLFEKGVDKILKKVGEEAAEVIIAAKNRSHDELKWEAADLL
YHLLVLLREQKLPLDAVLATLAERHAQKVEAGDKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggacattcgctttgatgaaaaagggcttgtacctgccatcgtccaagatgcg
caaagcaaggaagtgctcacgcttgcctatatgaacaaagagtcgcttaaaaaaacgctg
gagaccggagaaacatggttttacagccgctcgcgccaagaactatggcataaaggggcg
acatctggaaacgtgcagcgcgttgtcgacatccgctacgactgcgacgccgacgccctg
ctcgttctcgtcgagccggccggcccggcttgccataccgggtcgtattcctgtttttcc
cgctcgctggacggcgcggcgcgcacgccggcggccgaccggttcgcgattttgcatgag
cttgaacaaatcatcgcccagcgcgacgccgaacggccggaagggtcgtacacgacgtac
ttgtttgaaaaaggcgtcgataaaattttgaagaaagtcggcgaagaagcggcggaagtc
atcatcgcggcgaaaaaccggagccatgacgaattgaaatgggaagcggccgacttgttg
taccatttgcttgtactgttgcgcgaacaaaagctgccgcttgacgcggtgcttgcgacg
cttgccgagcggcacgcgcaaaaggtggaagcgggcgacaaaaaataa

DBGET integrated database retrieval system