KEGG   Geobacillus kaustophilus: GK3180Help
Entry
GK3180            CDS       T00217                                 

Definition
(GenBank) amylopullulanase
Organism
gka  Geobacillus kaustophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase AMPK1_CBM CBM_20 Malt_amylase_C Alpha-amylase_N fn3 DUF2369 DUF5060 RGI_lyase hDGE_amylase DUF4959 CBM_4_9
Motif
Other DBs
NCBI-ProteinID: BAD77465
UniProt: Q5KV21
LinkDB All DBs
Position
complement(3206217..3211199)
Genome map
AA seq 1660 aa AA seqDB search
MAKQRRRERGMIKRARRMLSLVLASVLLLALTPFQAVAAANEAGSSSALGNGAHRWTAES
TASQPRTITLVGTLQDELGHTAEWDPGALATRMHDEGNGLYTFTGTLPAGTYEYKIAVNG
SWDENYGAGGRNGDNLVLKLDRQTEVTFYYHDRTHAIADSTWYTAIAKEKQPRLVGTVLP
AIGYEGENDGWTPGTSTALLTDDDFDSVYTFTAQVPKGSYEYKIVLGNNWNESYPQENAR
LTVLETTTITFFFNAKTKEVYTDYNPNGSDGVVQKDRLKHNTWDTLYRQPFGAVKAGTKV
TLRLAAKKGDLTKADVYVKNATTGTAKVYTMEKVSVLGDDEYWEVAFTPSTPGVYGYKFI
AQDAGTKVEYGEDTQEGQWGKAVDSRAELFQLTVYDPDYRTPDWMKEAVVYQIFPDRFFN
GNPSNDNSKQQARGAQPIEHRDWSDLPDNPRLKGTSGYDGDGEWSNDFFGGDVAGIEQKL
DYLQSLGVNTIYLNPIANAPSNHKYDASNYKELDPMFGSPEEFQSFVQELAKRGMHLILD
GVFNHVSDDSIYFDRYHRYPTVGAYEYWEAVYDLMNEKGLSEEEARKQAEEKFKQQEQTF
SPYGFHLWFNIENEKVDGRYKYQSWWGYDSLPEFKSVTGEKVPNPSELNNDALANYIFRE
SDSVAKSWIARGASGWRLDVANEVDPAFWREFRQELLQGSYDRGPTLKEGEQPLILGEIW
DDASKYFLGDQYDSVMNYRFRGAVLDFLRNGNAEEADQRLTAIREDYPSEAFYALMNLIG
SHDTARAVFLLGNGTDSFERAEFDPNYNEELGKKRLKLAAILQMGYPGAPTIYYGDEAGV
SGSKDPDNRRTYPWGKEDQNLLAHYRKVGQIRQHHQTLLAHGDIKTLYAQGDVYVFARQY
GRDVAIIAVNRGNEDRTVALDVASWLPNGTVLTDELHDGGKATVADGTLTVTIPALDGRM
MFGTVTAEMPAAVRNLQASAVVGGVTLTWEGQASKYRVYQSTIQGAGYTLAAETNGTSVT
IDSLANGTAYYFAVTAVDENGNESPKVETNRVVPHYPLTSDNVQFVTTLSDATLDLSQPQ
PIDVKVNIDGVTSKGAADGLQAVLQVKGPHDEAWKEYRAVYQGQDGDANVFRAAFTPLVA
GTYTYRYALTTNLGEDWVYTEAKQVTFAADSSDQKAPAEAIALTPPPVESGQVHLSWQFV
GKNDADAYLLVIERNGTVIHMTTSISTSFVDYGVENGTEYAYVVKLYDRAGNVTASNTVK
VKPDIVMVKVIFKVKAPDYTPLDARITIPNSLNGWNTGAWEMSRNGAVTPDWQFTTEVQE
GETITYKYVKGGSWDQEGLADHTPADVGDDDVSYYGYGSIGTDLKVTVHNEGNNTMVVED
RILRWIDMPVVIEEVKKQGSQVTIKGNAIKNGVLTINGERVPIDDRMSFSYTFAPASHQK
EVSIHIEPSAESKTAIFNNDGGAIAKNTKDYVLNLETKQLREGKLTTPPSNGDSPGSETP
SHDGGATPGNGTSPGSGGPSDGASPGGSVPPGGTAPPGNEAPPSRPPQKPSPSKPKEKPR
KPTTPPGQVKKVYWDGVELKKGQIGRLTVQKPINLWKRTKDGRLVFVRILQPGEVYRVYG
YDARFGGQYAVGGGYYVTDIDTHIRYETPSKEKLKLVNGE
NT seq 4983 nt NT seq  +upstreamnt  +downstreamnt
ttggccaaacaaaggagaagggagcgggggatgatcaagagggcaaggagaatgctatca
ttggttttggcatcggtgttgttgctggcattgactcctttccaggcggttgccgctgcg
aacgaggcaggaagttctagcgctctagggaatggagcgcatcggtggacggccgaatcc
acggcctcgcaaccacggacgatcacgctcgtcggcacgctacaagatgaattgggccat
acggcggaatgggatccgggggcattggcgacgaggatgcatgatgaagggaatgggctt
tatacattcaccgggacgctgccggctgggacgtatgagtacaaaattgcggtcaatggc
agctgggatgaaaactacggagccggcggccgcaatggcgacaatctggtgttgaagctg
gatcggcaaaccgaggtgacgttttattaccatgaccggacgcatgcgatcgcggattcg
acatggtatacggcgattgcgaaggagaaacagccgcgcctcgtcgggacggtgctgccg
gccatcggctatgagggggagaacgatggatggaccccggggacatcgacggcgctgttg
accgatgacgatttcgactcggtgtacacgtttacggcgcaggtgccgaaagggtcgtat
gaatataaaatcgtcctcggaaacaattggaacgagagctacccacaagagaatgcacgc
ttaaccgttttggaaacgacgaccattacattcttcttcaatgcgaaaacaaaagaggtg
tacaccgactacaaccccaatggctctgacggtgttgttcagaaagaccgattaaaacac
aatacatgggatacgctgtaccgccagccgtttggtgcggtgaaagcgggaacgaaggtg
acgcttcgtctggcggcgaaaaaaggcgatttgacgaaggcggatgtgtatgtgaaaaat
gcgacgaccggaaccgccaaagtctacacgatggaaaaagtcagcgtgctcggggatgat
gaatattgggaggtggcgttcaccccttcgacgcccggggtgtacgggtataaatttata
gcgcaagatgccggaacgaaagtggaatacggcgaagatacgcaagaagggcaatggggg
aaagcggtggacagccgcgcggagctgtttcaactgacggtgtatgatccggattacagg
acgcccgactggatgaaagaagcggttgtgtatcaaattttcccggatcggttctttaat
ggcaacccttcaaatgataacagcaagcagcaggcacgcggggcgcagccgattgagcat
cgcgattggtcggatttgcccgataatccgcgcctgaaagggacgagcggctacgatggc
gacggcgaatggtcgaatgactttttcggcggagatgtggccgggattgaacagaagttg
gattacttgcagtcgcttggggtgaacacgatttacttaaacccgatcgccaatgcaccg
tcaaaccataaatacgatgcaagcaattacaaagaattggatccgatgtttgggtctccg
gaagagtttcaatcatttgttcaggaactggcgaaacgggggatgcatctcatcttagac
ggcgtgttcaaccacgtatccgatgattcgatttactttgaccgctatcaccgttatccg
acggtcggcgcctatgaatattgggaagcggtttacgatttgatgaacgaaaaaggattg
agcgaggaggaagcgcggaaacaggcggaagagaagttcaaacaacaagagcaaacgttc
agcccgtatgggtttcatctttggttcaatattgaaaacgaaaaagtcgatggtcgttat
aagtatcagtcatggtggggctatgacagtctgccggagtttaagtcggtgacgggggaa
aaagtgccgaatccgagtgaattgaacaacgatgcgctcgcaaattacattttccgtgaa
tcggattcggtggcgaaaagctggattgcccgcggcgcctctgggtggcggttggatgta
gcgaatgaggtggatccggcgttttggcgcgagtttcgccaagagttgcttcaaggatcg
tacgaccgcggcccgacgttaaaagaaggggagcagccgctcattttaggggaaatttgg
gatgacgcatcgaaatattttctaggcgaccagtacgattccgtgatgaactaccggttc
cgcggggcggtgcttgactttttgcgaaatgggaatgcagaagaggccgatcagcgactg
acggccataagggaagactacccgagcgaagcgttttatgcgctgatgaatttgatcggt
tcgcatgacacggcgcgggcggtctttctgcttgggaacggaacggattcattcgagcgg
gcggagtttgatccgaattataatgaagaacttggaaaaaagcggctcaagctagcggcg
attttgcagatgggatatccgggggcgccgacgatttattacggtgatgaagcaggggta
agcggctccaaagatccggacaaccgtcgtacgtatccgtggggtaaagaagatcaaaat
ctgttggcgcactatcggaaagtcggtcaaattcgccagcaccatcaaacgctgttggcc
catggcgacatcaagacgttgtatgcgcaaggggatgtatacgtctttgcccgccaatac
ggtcgtgacgtggcgatcattgccgtcaaccgtggcaatgaggacagaacggtggcgctt
gacgtcgcttcgtggctgcccaacggcaccgtgctgacggatgagttgcatgatggcggg
aaagctacggtcgctgacggaacgttgacggtcacgattccggccttggacggacggatg
atgtttgggacggtgacggcagaaatgcctgccgcggtcagaaatttgcaggcaagcgcc
gtggttggtggcgtgacgcttacttgggaagggcaagcgtcgaagtatcgggtgtaccaa
tcaaccattcaaggggctggttatacgttagcggcggaaacgaacgggacttccgtgacg
atcgattcgttggcgaacgggaccgcgtattactttgccgttaccgccgtcgatgagaac
gggaatgagtcgccaaaggtggaaacgaatcgcgtcgttcctcattatccgctgacgagc
gacaatgtccagttcgtgaccacgttaagcgatgccacactcgacttgtcccagccgcaa
ccaatcgatgtcaaagtgaacatcgacggtgtgacaagcaaaggagcagccgatggattg
caagcggtgttgcaagtgaaagggccgcatgacgaagcatggaaagaatatagagcggtt
taccaagggcaagatggcgacgctaatgtgttccgtgccgccttcaccccgcttgtggca
gggacgtatacgtatcgctatgcgctgacgaccaaccttggcgaggattgggtgtatacg
gaagccaaacaagtgacgtttgcggccgactccagcgaccaaaaagcgccggccgaggcg
attgcgctgacgccgccgcctgttgagtcagggcaagttcatttgtcatggcagtttgta
ggaaaaaatgatgcggatgcatacttgctagtcatcgaacgcaatggaacagtcattcat
atgacgacatccatcagcacatcgttcgttgattacggggtcgaaaacggcaccgagtat
gcgtacgttgtcaagctgtatgaccgcgctggaaatgtcaccgcgtccaacacggtcaaa
gtgaagccggacattgtgatggtgaaagtcatttttaaagtcaaagccccagactatacg
ccgttagatgcccgaattacgattccgaacagtttgaacggctggaacacaggggcatgg
gaaatgtcgcgcaatggagcggtgacgcctgattggcaatttacaactgaagtgcaagaa
ggggaaacgatcacgtataagtatgtgaaaggcgggtcgtgggatcaggaagggctggct
gatcatacgcctgcagacgttggggatgatgatgtcagttattatggatacggctcgatc
ggcacggatttgaaagtgaccgttcacaatgaaggaaacaatacgatggttgtggaagac
cgcattttgcgctggattgatatgccggtggtcatcgaagaggtgaaaaaacaagggagt
caagtgacgatcaagggcaatgccattaaaaatggcgttttgacgatcaacggtgagcgg
gtgccgattgatgaccggatgtcattctcgtacacgtttgcgccggccagccatcaaaaa
gaagtgtcgattcatattgaaccatcggctgaaagcaaaacagccattttcaacaacgac
ggcggagcgattgcgaaaaacacgaaagattatgtgttgaatttagaaacgaagcaattg
cgcgaagggaagttgacaacgccgccaagcaacggcgattctccgggaagcgaaacgccg
tcccatgacggaggggcaacaccaggcaacggcacctctccgggcagcggtggtccatcg
gatggcgcatcccctggggggagcgttccgccgggcggcacagctccaccgggaaacgaa
gcgcctccatccagaccgccgcaaaaaccgtctccatcgaaaccaaaagagaaaccgaga
aagccaaccactcctccaggccaagtgaaaaaagtgtactgggatggcgtggagttgaaa
aaagggcaaatcggccgcttgacggtgcaaaagccgatcaatctatggaaacggacgaag
gatgggcgccttgtgttcgtccgcatcttacagcctggggaagtataccgcgtctacggg
tatgatgcgcgcttcggcgggcagtacgcagtcggcggcgggtattacgtgaccgacatc
gacacgcacatccgctatgaaacgccgtcaaaggagaagttgaagttggtgaatggggag
taa

DBGET integrated database retrieval system