KEGG   Geobacillus kaustophilus: GK3198Help
Entry
GK3198            CDS       T00217                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00010  Glycolysis / Gluconeogenesis
gka00620  Pyruvate metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GK3198
   00620 Pyruvate metabolism
    GK3198
Enzymes [BR:gka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GK3198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: BAD77483
UniProt: Q5KV03
LinkDB All DBs
Position
3232264..3233784
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEENLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDEFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELAGGYYVKPTIFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgagtatttcgaaaatatcacg
ccaatcaccggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactg
gcgcttgacgccgcccatgcggcaaaagacgcatggggacgcacgtctccagcggagcgc
gcccgtttgttgaacaaaatcgccgaccggatggaagaaaacttggaaatgctcgccgtt
gcggaaacatgggaaaacggcaagccgatccgcgaaacgttggcggctgacatcccgctt
gccatcgaccatttccgctacttcgccagctgcattcgcgcgcaagaaggcacgatttcg
gaaatcgatcacgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcgggcaa
atcatcccgtggaacttcccgattttaatggcggcctggaaactcgctccagcgctcgcg
gccggcaactgcgtcgtcttgaaaccggcggagcaaacgccgacgtcgatcctcgttctc
atcgaactcatcgaggatttgcttccacctggcgtcgtcaacatcgtcaacggctttggc
ttagaagccggcaagccgctcgcctcgaacccgcgcgtggcgaaagtggcgttcaccggt
gaaacgacgaccggacggctcatcatgcagtacgcctcgcaaaacatcgtgccggttacg
cttgagcttggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagacgac
gagtttctcgataaagcgctcgaaggctttacgatgttcgccttaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccatgagtcgatttacgacgcctttatggaacgg
gcgcttgagcgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacgatgatc
ggcgcccaagcctcctccgaacagctcgagaaaattttgtcatacatcgacatcggcaaa
caggaaggcgctgagctcttgatcggcggcgagcggaacatgctcgaaggagaactcgcc
ggcggatactatgtcaagccgacgattttcaaagggcataacaaaatgcgcattttccaa
gaagaaattttcggcccagtgctcgcggtcacaacgtttaaagatcacgacgaagcgctt
tcaatcgccaatgaaacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccgcttcggccgcggcatccaagcaggccgcgtctggacgaactgctatcac
gtctatccggcccacgcggcgtttggcggctacaaaatgtccggcatcggccgcgaaacg
cacaaaatgatgctcgaccattaccaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaacttggcttgttctaa

DBGET integrated database retrieval system