KEGG   Geobacillus kaustophilus: GK3338Help
Entry
GK3338            CDS       T00217                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00430  Taurine and hypotaurine metabolism
gka00460  Cyanoamino acid metabolism
gka00480  Glutathione metabolism
gka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    GK3338
   00460 Cyanoamino acid metabolism
    GK3338
   00480 Glutathione metabolism
    GK3338
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gka01002]
    GK3338
Enzymes [BR:gka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     GK3338
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     GK3338
Peptidases and inhibitors [BR:gka01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   GK3338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAD77623
UniProt: Q5KUL3
LinkDB All DBs
Position
complement(3380262..3381872)
Genome map
AA seq 536 aa AA seqDB search
MAMDYLYHPYPSQRMTVFAKNGVVATSQPLAAQAGLEVLKKGGNAIDAAIAAAACLTVVE
PTSNGIGGDAFALVWTNGKLYGLNASGYAPKAISIEALKERGYTEMPKYGFAPVTVPGAP
AAWAALAKRFGRLPLAETLAPAIAYAENGYPVSPVLGKYWANAYRVYKEALNGPEFASWF
ATFAPGGRAPKIGEVWASPDHAATLRSIAETEAESFYRGELAEKIATFSKQYGGFLAADD
LAEYEPEWVEPISVSYRGYEVWEIPPNGQGIVALMAINIMNGFDVPSVPDVETHHRQIEA
MKLAFADGKAYIADCRYMNCSPDELLSESFAAMRRAQIGEEALTPEPGTPPKGGTVYLAA
ADGEGNMVSYIQSNYMGFGSGLVVPGTGIALHNRGHNFAFDEGHPNGLAPRKKPYHTIIP
GFLTKGGAPVGPFGVMGGFMQPQGHLQVIMNTIDFDLNPQAALDAPRWQWMEGKTVLVEP
HFPRHIAEALARKGHDIRLALDSGLFGRGQIIWRDPDTGVLAAGTEPRTDGAVAAW
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtggccatggactacctataccacccatacccatcgcagcggatgacggtgttcgccaaa
aacggcgttgtggcgacatcgcagccgctcgcggcgcaagcggggcttgaggtgctgaaa
aaaggcggcaacgccatcgatgccgccattgccgccgccgcctgtctgacggtcgtcgaa
ccgacatcgaacggcatcggcggcgatgcgttcgctctcgtctggacgaatgggaaactg
tacgggctgaatgcgagcggctatgcgccaaaagcgatctcgatcgaagcgttgaaagag
cgcggctatacggagatgccgaagtacggttttgccccggtgaccgtgccgggcgcgccg
gcggcgtgggcggcgctggcgaagcgcttcggccgcctgccgcttgccgaaacgctcgct
ccggcgatcgcctatgcggaaaacggctacccagtatcgccggtgctgggcaaatactgg
gcgaacgcttatcgggtgtacaaagaagcgctgaacgggccggagttcgcctcgtggttt
gcgacgtttgcgccgggcggccgcgcgccgaagatcggggaagtgtgggcgtctccggac
catgcggcgacgctccgctccattgccgaaacggaggcggaaagcttttaccgcggcgag
ctggcggaaaaaatcgccaccttctcgaagcaatacggcggctttttggcggcggacgac
ctcgccgagtacgaaccggaatgggtcgagccgatctccgtctcctaccgtggctatgaa
gtgtgggaaattccgccgaacggccaagggattgtcgcgttgatggccatcaacatcatg
aacgggtttgacgtgccgagcgtgccggatgtcgagacgcaccaccggcaaatcgaggcg
atgaagcttgcctttgccgatgggaaagcgtacatcgccgactgccgctatatgaactgc
agcccagacgagctgttgtcggaatcgtttgccgcgatgcgccgggcgcaaatcggcgag
gaggcgctgacgccggagccgggaacgccgccaaaaggcggaacggtctatttggccgcc
gcggacggcgaagggaatatggtgtcctatattcaaagcaactacatgggcttcggctcg
ggcctcgtcgtcccaggaacgggcattgccttgcacaatcgcggccataacttcgccttt
gatgaaggccatccgaacgggctggcgccaaggaaaaagccgtaccatacgatcatcccc
ggctttttgaccaaaggcggcgcgccggtcggcccgttcggtgtcatgggcggatttatg
cagccgcaagggcatctgcaagtgatcatgaacacgatcgattttgacttaaacccgcaa
gcggcgctcgatgcgccacgttggcagtggatggaagggaaaacggtattggtggagccg
cacttcccgcgccatatcgctgaagcgctcgcccgcaaagggcatgacatccgcttggcg
ttggacagcggactgttcggccgcgggcaaatcatttggcgcgatcctgacaccggcgtg
ctcgccgccgggacggagccgcgcacggacggtgcggtggccgcttggtga

DBGET integrated database retrieval system