KEGG   Glaesserella sp. 15-184: CJD39_03245Help
Entry
CJD39_03245       CDS       T05643                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
gle  Glaesserella sp. 15-184
Pathway
gle00220  Arginine biosynthesis
gle01100  Metabolic pathways
gle01110  Biosynthesis of secondary metabolites
gle01130  Biosynthesis of antibiotics
gle01210  2-Oxocarboxylic acid metabolism
gle01230  Biosynthesis of amino acids
Module
gle_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:gle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CJD39_03245
Enzymes [BR:gle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     CJD39_03245
    2.3.1.35  glutamate N-acetyltransferase
     CJD39_03245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AUI65648
LinkDB All DBs
Position
complement(701471..702691)
Genome map
AA seq 406 aa AA seqDB search
MNTTAILGGVTAPQGFKASGIHCGIRKNKEKLDLALLVSDVPCATAAVYTQNKVKGAPIL
VTKANIADGYSQAMMCNSGNANTCNPNGIELAEKCCEMVATALNLKASDIVIASTGVIGQ
PLPLEPFEQGIPKAVASLSYQGGTQAAEAIMTTDTRLKEYAVAFELGGKTCHMGIMTKGS
GMINPNMATMLTFITTDVAISPEMLNLALKKEIKQTINQINVDGDTSTNDMASIMANGLA
GNTPITQTGADFDLFCQVLNHVCIWACRQIAFDGEGATKLLECTVTNARTEDVALAVSKS
IISSDLFKSAMFGEDANWGRVLCAIGYTEGDFSIDGVSLKLKSEKGEVLVCQNAMYHPFS
EEKAAEVLSAPHIEILVDMNDGTANAQAWGCDLTYEYVKINGDYRS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaacagcaattttaggcggcgtgaccgcaccacaagggtttaaagcaagcgga
attcattgcggtattcgtaaaaataaagaaaagttagatttagccttacttgtcagtgat
gtaccttgtgccacagccgctgtttatacacaaaataaagtcaaaggcgcacctatttta
gtgaccaaagcgaatatcgccgacggctatagccaagcgatgatgtgtaatagtggcaat
gccaacacttgtaacccaaacggtattgaacttgctgagaaatgttgtgaaatggttgca
actgcgttgaatttaaaagcaagtgatattgtgattgcatcaacaggggtaatcggtcag
ccgctcccgttagaaccgtttgaacaaggcattccaaaagccgtcgcaagtttaagctat
caaggtggtacacaagcggcagaagcgattatgaccaccgatactcgccttaaagagtat
gccgtcgcctttgaattaggcgggaaaacttgtcatatgggcatcatgaccaaaggcagt
ggtatgatcaatccaaatatggcaaccatgctgacctttattactacagatgtggcgatc
agtcctgagatgcttaatcttgccttgaaaaaagagattaaacagactatcaatcaaatc
aacgtcgatggcgatacttcgactaacgatatggcaagcattatggcaaacggcttagcg
ggtaatacgcctatcacgcaaacaggggctgatttcgatctgttctgccaagtgttaaat
catgtctgtatttgggcttgtcgccaaattgcctttgacggcgaaggcgcaaccaaatta
ttagaatgtaccgtcactaacgctcgtactgaagatgtcgcccttgcggtatcaaaaagt
attatttcaagcgacttatttaaatctgctatgtttggcgaagatgcaaactgggggcgt
gtgctttgtgcgattggctataccgaaggcgacttctctattgatggcgtatcgttaaaa
ttaaagagtgaaaaaggcgaagtacttgtctgtcaaaacgccatgtatcacccatttagt
gaagagaaagcggcagaagtattaagcgcaccgcacattgaaattttagttgatatgaat
gatggcacagccaatgcacaggcttggggctgcgatctcacttatgaatatgtcaaaatc
aacggcgattatcgtagttag

DBGET integrated database retrieval system