KEGG   Glaesserella sp. 15-184: CJD39_04680Help
Entry
CJD39_04680       CDS       T05643                                 

Definition
(GenBank) fatty-acid oxidation protein subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gle  Glaesserella sp. 15-184
Pathway
gle00071  Fatty acid degradation
gle00280  Valine, leucine and isoleucine degradation
gle00281  Geraniol degradation
gle00310  Lysine degradation
gle00362  Benzoate degradation
gle00380  Tryptophan metabolism
gle00640  Propanoate metabolism
gle00650  Butanoate metabolism
gle00903  Limonene and pinene degradation
gle00930  Caprolactam degradation
gle01100  Metabolic pathways
gle01110  Biosynthesis of secondary metabolites
gle01120  Microbial metabolism in diverse environments
gle01130  Biosynthesis of antibiotics
gle01200  Carbon metabolism
gle01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CJD39_04680
   00650 Butanoate metabolism
    CJD39_04680
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CJD39_04680
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CJD39_04680
   00310 Lysine degradation
    CJD39_04680
   00380 Tryptophan metabolism
    CJD39_04680
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CJD39_04680
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CJD39_04680
   00281 Geraniol degradation
    CJD39_04680
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CJD39_04680
   00930 Caprolactam degradation
    CJD39_04680
Enzymes [BR:gle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CJD39_04680
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CJD39_04680
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CJD39_04680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DGOK
Motif
Other DBs
NCBI-ProteinID: AUI65911
LinkDB All DBs
Position
complement(1018031..1020148)
Genome map
AA seq 705 aa AA seqDB search
MTEQVQKVSPFQVEVDDNRIAIVRINVQNQNKNWLPEQFIEDLRDVIGTVIYQQARGVIF
VSGKAKGFVQGFDLDEFQGKTDEQLRALSNNAQLVMREINTLKMPVVAVIDGACYGLGLE
LALACDYRIASEESYTQFAMPQIRSGILPFAGGTQRLPRLVGLQHAVTMLLSGHKIGAEK
ALKIGLVNKLIPVGNLFETAYQLLLDNRIAKIDHKNPLDKFTKWRKQLEGNRFIRHKYLD
HIENRVWDKAFGNYPAVPKMLELLKEPHFKAGLVLEQEALLELIRTEQAQVLMNLKKTER
AMKEQYADLGHIKDIQQVSVLGSGYMGAGIAYLTANHAQIPVRIKDIHPSEIQKALQMCY
GLMQKAVTKKQLSHGEMIQRMNLITGGERLVAARSTDFIIEAVYEKLELKQQMVKESEAY
YTENAIFATNTSTFSIKEIASVAKRPENVIGFHYFSPVTKRQMVEVIPHETTGPKAISTA
VHFAIQQGKIPMLVADKEGFFINRILTPFLLEAIECLSEGEGIEFVDRSLQEFGFKIGPL
AMIDDIGLDILVKSNPAMVEKLGKRFVLPSSIQKLMTDDRKGRKNKRGFYLYDSKGQRTQ
EDKSIYHTMETIMRNELEAQEIARRCVLRMINEACWCLQDNVIRSTDEGNVASVLGFDFP
DFRGGIYAYIERVGAKEIVHQLRKHTQRYGDRFTPCDWLLEQAQE
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaagtacaaaaagtctcaccatttcaggttgaagtggatgataatcgtatt
gctattgtgcgtatcaatgttcaaaatcaaaataaaaattggctaccggaacaatttatt
gaagatctgagagatgttattggaaccgttatttatcaacaagcacgaggtgtgattttt
gtttctggtaaagcaaagggctttgttcaaggatttgatttagatgaatttcaaggtaaa
acggatgaacaattaagagcgctttctaacaatgctcaacttgtgatgcgtgagattaat
accttaaaaatgcctgtagtggcggtgattgatggggcttgttatggacttggattagag
cttgcgcttgcttgtgattatcgtattgcaagtgaagaaagctatactcagtttgcaatg
ccccagattcgttcggggattttaccttttgcaggtggaacacagcgtttaccaaggtta
gtagggttacaacatgcagtaacaatgcttctttcaggacataaaattggtgcagaaaaa
gcgttaaaaatcggtttggttaataaacttattcctgttggaaatctctttgaaaccgct
tatcagctgttattggataatcgtattgcaaaaatcgatcataaaaacccattagataaa
ttcactaaatggcgtaaacagcttgaaggtaatcgctttattcgtcataaatatttagac
catatagagaatcgtgtctgggataaggcttttggtaactatcctgctgttccaaaaatg
ttagagttattaaaagagccacactttaaagctggcttagtgttagaacaagaagctcta
cttgaattaattcgtacagagcaagctcaagtattgatgaatttaaagaaaactgagcgt
gcgatgaaagaacagtacgctgatttaggtcacattaaagatattcagcaggtgagtgtt
ctcggtagtggctatatgggagcaggcattgcttatttaaccgcaaatcatgcgcaaatt
cctgtgcgtattaaagatattcatccatctgaaatccaaaaagcattacaaatgtgttat
ggattaatgcaaaaagcagttacaaagaaacagcttagtcatggtgaaatgattcaacga
atgaatctgatcactggtggtgaacgtttagttgcggctagatccacagattttattatt
gaagcggtttatgaaaaactagaacttaaacaacaaatggtgaaagaaagtgaagcctat
tacactgaaaatgctatttttgcgacgaatacttcgactttctcaattaaagagattgca
tctgtggcaaaacgtccagaaaatgtgattggtttccactattttagcccagtcaccaaa
cgccaaatggtagaagtgattccacatgaaacaacaggcccaaaagcgatttctacggcg
gttcattttgccattcagcaaggaaaaattcctatgttggtagcagataaagaaggcttt
ttcataaaccgtattttaactccattcttacttgaagcgattgaatgtttatctgaaggg
gaaggtattgagtttgttgatcgttcgttacaagagtttggttttaaaattggaccattg
gcaatgattgatgatattgggttagatattctagttaaatctaatcctgcaatggtcgag
aaattaggaaagcgttttgtattaccaagcagcattcaaaaattaatgacagatgatcgt
aaaggtagaaaaaataaacgtggtttctatctttatgattctaaaggtcaaagaacgcaa
gaagataaaagtatctatcacacaatggaaacaatcatgcgtaatgaattagaagcacaa
gaaattgctcgacgttgtgttttacgtatgattaatgaagcttgttggtgcttacaagat
aatgttatccgttcaacggatgaaggaaatgtggcctctgttttaggttttgatttccct
gactttagaggtggaatctatgcttatattgaaagagttggagctaaagaaattgttcat
cagttacgtaagcacactcaacgttatggtgatcgttttacaccttgtgattggctatta
gaacaagcacaggaataa

DBGET integrated database retrieval system