KEGG   Glaesserella sp. 15-184: CJD39_06100Help
Entry
CJD39_06100       CDS       T05643                                 

Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
gle  Glaesserella sp. 15-184
Pathway
gle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gle01100  Metabolic pathways
gle01110  Biosynthesis of secondary metabolites
gle01130  Biosynthesis of antibiotics
gle01230  Biosynthesis of amino acids
Module
gle_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:gle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJD39_06100
Enzymes [BR:gle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CJD39_06100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin AAA_24 AAA dNK AAA_5 AAA_17 AAA_22 TsaE AAA_16 ABC_tran TraC_F_IV Mg_chelatase APS_kinase AAA_PrkA AAA_29 AAA_28 CoaE Ploopntkinase3 AAA_7 RNA_helicase AAA_23 IstB_IS21 AAA_25
Motif
Other DBs
NCBI-ProteinID: AUI66176
LinkDB All DBs
Position
complement(1313623..1314144)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRQLAQMLNMDFLDSDAVIEERAGADIDWIFDIEGEAGFR
KREERILNELTQSQGLVLSTGGGSVLSKDNRNVLSARGIVVYLETTVDKQFERTQRDKKR
PLLQTEDPYQTLQELAKVRNPLYEEIADIILQTDEQSAKVVATQIIDMIDNLQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacgtaatattttcttaattggtcccatgggcgctggtaaaagcactatt
ggtcgtcaattagcacaaatgttaaatatggactttttagactcagatgctgtgattgaa
gaacgtgcaggagcagatattgattggatttttgatattgaaggcgaagcaggttttcgt
aaacgtgaagagcgtatattaaatgagctaactcagtctcaggggttggtactttctact
ggtggtggttcagtactttctaaagataatcgtaatgtcttatctgctcgtggtattgtt
gtttatctagaaacaacggtagataagcaatttgagcggactcagcgtgataaaaagcgt
ccattgctacaaacggaagacccatatcaaactttacaagaattagcaaaagttcgtaat
cctttatatgaagagatcgcagatattattttgcagaccgacgagcagagtgcaaaagta
gtcgcaacacaaatcattgatatgattgataatttacagtaa

DBGET integrated database retrieval system