KEGG   Glaesserella sp. 15-184: CJD39_06105Help
Entry
CJD39_06105       CDS       T05643                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
gle  Glaesserella sp. 15-184
Pathway
gle00550  Peptidoglycan biosynthesis
gle01100  Metabolic pathways
gle01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:gle00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CJD39_06105
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CJD39_06105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gle01003]
    CJD39_06105
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gle01011]
    CJD39_06105
Enzymes [BR:gle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CJD39_06105
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CJD39_06105
Glycosyltransferases [BR:gle01003]
 Polysaccharide
  Bacterial polysaccharide
   CJD39_06105
Peptidoglycan biosynthesis and degradation proteins [BR:gle01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CJD39_06105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AUI66177
LinkDB All DBs
Position
complement(1314377..1316980)
Genome map
AA seq 867 aa AA seqDB search
MKIVKIIFSALLTLIIVGAISAGFLYVHLKEDLPDVASLKTVELQQPMQIFTADGKLIGE
VGEQRRIPVKLDDIPQTLIDAIIATEDTRFYEHKGIDPKGIMRAVWRSSQGDTQGASTIT
QQLARNFFLSPERKLERKLKEIILALEIENNLSKREILELYLNKIYLGYRSYGVAAAAKT
YFGKKLNELTLSEIAIIAGLPKAPSTMNPLFSVKRAENRRNVVLGRMLEVGKITKEQYEQ
AKAETIKARYYGSALEFRADYVTEMIRQEMVKRYGEEVAYTRGFQVYATVLSADQREAQT
ALRDNLIDYDRRHGWRGAEKLWNPKDRAWDEEKIIEHLSKLPNSEPFIGAAVLSVSKDKA
KIMLPNGDQVDLKMASMRWARKFINDSAQGKAPTQVKDVINVGEQIWVRQNSKGEWELGQ
IPDVNSALVSLNSDNGAIEAIVGGFSFEQSRFNRATQSLVQVGSSIKPFIYAAALNKGLS
LSTTLSDTPITITKRGQKPWTPKNSPNVYEGSLRLRVGLGKSKNVMMVRAVQMAGVEYVA
DYLQRFGFNREQYQATEALALGAASFTPLEMARAYAVFDNGGYLIEPYIIDRILDSAGNE
LFKANPAIACLECSDKPVIYPEPEYFDFVKIEEQKSKDEEIAEAPKDEESDLIPELEITT
AKKDAPSLMADSAITNNEIHYAPRVISGEIAFLMRSALTTAITGEKGQSWKGTSWRVANE
IKRKDIGGKTGTTNNAKVTWYAGFGANIVTAVYVGFDDNKRELGRGEAGAQTALPAWIKY
MKVALSDKEEREEILPANIIEVKIDPVSGFLGTGLTEFFIKGTEPTKRYIVEKAIQAPVQ
PQKHDALEQRLGLPPPGVLQHQGKELF
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgtaaaaatcatatttagtgctttacttacgctaataattgtgggcgcaatt
tctgcgggctttctttatgtccatttgaaagaagatctgccagatgtcgctagtttaaaa
accgttgagcttcaacaaccaatgcagatctttactgctgatggtaagctgattggagaa
gttggtgagcaacgtcgtattcctgtcaaacttgatgatattcctcagactttaattgat
gccattattgcgacagaagatactcgtttttatgagcataagggaatcgatccaaaaggg
attatgagggcagtttggcgttcaagccaaggtgatacacaaggtgcaagtactattaca
cagcaacttgcgcgtaactttttcctttcaccagagcgtaagcttgaacgtaagctcaaa
gaaattattttagcgttggaaattgagaacaatctctctaaacgtgaaattttggaactt
tatcttaataagatttatctcggttatcgttcttatggtgtagctgcagctgcaaaaacg
tattttggtaaaaaattaaatgagttaacgttgtctgaaattgccattattgcaggattg
cctaaagcgccttcaacgatgaatccgctgttttcggtaaaacgtgctgaaaatcgtcgt
aatgttgttcttggccgaatgcttgaagtaggcaaaattacgaaagagcaatatgagcag
gctaaggcagagacaattaaagctagatactatggttctgctctagaatttagggctgac
tatgtcactgaaatgattcgtcaagaaatggtgaaacgctatggcgaagaagtggcttat
acaagaggctttcaagtttatgccacagtgttatcggcagaccaaagagaagcgcaaact
gcattaagagataatttaattgattacgatcgtcgtcatggttggcgtggtgcagaaaaa
ttatggaatccgaaagaccgtgcttgggatgaagaaaaaattattgagcatttaagtaaa
ttaccaaattcagagccttttattggagctgctgttttatcggtatctaaagataaagct
aaaattatgcttccaaatggtgatcaagtagatctaaaaatggctagcatgcgttgggca
aggaaatttattaatgattccgctcaaggcaaagccccgactcaagttaaagatgtaatt
aatgttggcgagcagatttgggtgcgtcaaaatagtaaaggcgaatgggaacttggacaa
attcctgatgtgaactcagcgttagtttctcttaatagtgataatggggcgatagaagct
attgtcggtggttttagcttcgaacagagccgttttaatcgtgcaacacaatcgctagtt
caggtcggttcatctattaagccgtttatttatgcagctgccttaaataaaggcttaagt
ctttcaacaacgttaagcgatacacctattactattactaagcgtggtcaaaagccgtgg
acacctaaaaattctccaaatgtatatgaaggttctctacgtttgcgggttgggctaggt
aaatctaagaatgtgatgatggttcgtgcggttcagatggctggagttgaatatgttgct
gattatttacaacgtttcggctttaatagagaacagtaccaagcaacggaagcattagct
ttaggggcagcgtcattcactccattagaaatggcaagagcttatgcggtatttgataat
ggcgggtatttgattgagccttatattattgatcgtattttggatagtgcaggtaatgag
ttattcaaggcaaaccctgctattgcttgtttagagtgtagtgataagccagtgatctat
ccagaacctgagtattttgactttgtgaaaattgaagaacaaaaatcaaaagatgaggag
atagcagaagcaccaaaagatgaagaaagtgatttaattcctgaacttgagattacaaca
gctaaaaaagatgcgccaagcttaatggcagattctgctattactaataatgaaatacac
tatgctcctcgtgtaattagtggtgaaattgcatttttaatgcgaagtgcgcttacaaca
gcaatcacaggggaaaaaggtcaaagctggaaagggacaagttggcgtgttgcaaatgaa
attaagcgcaaagatattggtggtaaaacagggacaaccaataatgccaaagttacttgg
tatgcgggttttggtgcgaatattgtgacagcggtttatgtcggttttgatgataataaa
cgtgaattaggtcggggagaagctggtgcacaaacagcacttcctgcatggatcaaatat
atgaaagtggcactttctgataaggaagagcgagaagagatattgcccgctaatattatt
gaagtaaaaattgatcctgtaagtggctttttaggcacaggtttaacagagttttttata
aaaggtactgagccaactaaacgttatattgttgaaaaagcgattcaagcaccggttcag
cctcaaaaacatgatgctttggaacaacgtttaggtttacctccgccaggcgttttacag
catcaaggcaaagaattattttaa

DBGET integrated database retrieval system