KEGG   Geobacillus lituanicus: GLN3_02575Help
Entry
GLN3_02575        CDS       T05193                                 

Definition
(GenBank) nitrite reductase large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
gli  Geobacillus lituanicus
Pathway
gli00910  Nitrogen metabolism
gli01100  Metabolic pathways
gli01120  Microbial metabolism in diverse environments
Module
gli_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    GLN3_02575
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     GLN3_02575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Rubredoxin_C Pyr_redox NIR_SIR_ferr Pyr_redox_3 GIDA AlaDh_PNT_C 3HCDH_N Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ASS86103
UniProt: A0A223DT24
LinkDB All DBs
Position
complement(520030..522456)
Genome map
AA seq 808 aa AA seqDB search
MKRKLVLIGNGMAGVRCIEEILKLDREAFEITIFGSEPHPNYNRILLSKVLQGDTRLDDI
TLNSWEWYERNGIRLFVGETVTEVDIKRRLVRTDRGRVVEYDELIFATGSNPFILPVPGA
DLPGVTAFRDIQDCERMIEYAKTYKKAAVIGGGLLGLEAARGLLHLGMDVDVIHIFDYLM
ERQLDPTASKLLQRELEKQGMNVLLRKETAELFGNGRVEGVRFKDGTSIAADLVVMAVGI
RPNVDLARRSGIEVNRGIVVNDYLETSVPHIYAVGECAEHRGVVYGLVAPLYEQGKVLAQ
AICGRKGKPYEGSVVATQLKVSGVDVFSAGEFMDGEGTESIKLYDEARSVYKKVVVREGK
IVGAVLFGDTSEGRKLFDMIQRGDSVEALSLSLFAPTASGGKGSLAAAMADTDVVCGCNG
VTKGAICQAIAEHGLKTVAEVRDYTNASRSCGGCKGLVAELLEHMLGEEANRYAVKETIC
GCTDLSREEVVAAIKEKRLMTVKEVMSVLGWKNEEGCSKCRPALNYYLGMLYPGEYDEEA
ESLFVNERLHANIQADGTYSVVPRIYGGVTTAEQLRNIADVAEKYNVPMIKITGGQRIDL
LGVKKEDLPRIWADLGMPSGYAYAKALRTVKTCVGKQFCRFGTQDSTGLGIRMEQTFERL
KTPHKVKMAVSACPRNCAESGIKDVGVVGVEGGWEIYVGGNGGTHLRAADLLCTVKTEDE
VIEMTGAFLQYYRESAHYLERTSKWVERVGLEHIREVLFDVETRRALLERLHKALSATKD
PWREIVENDELQQTLFRDIGDKEPVPVE
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgaaaactcgtgttaatcggcaacggcatggcgggggttcgctgcatcgaggag
attttaaaacttgaccgcgaggcgtttgagatcacgatttttggcagcgaaccgcatccg
aactataaccgcattttgttgtcgaaggtgctgcaaggagatacgcgccttgatgacatt
acgttgaacagttgggaatggtacgaacgaaacggcattcggctgtttgtcggcgaaacg
gtgacggaagtcgacatcaagcggcggcttgtccggaccgaccgtgggcgggtagtcgaa
tacgatgaattgattttcgcgacagggtcgaatccgtttatcttgccggtgccgggagcc
gatttgcccggggtgacggcgtttcgcgatatccaagattgcgagcggatgatcgaatat
gcgaagacgtacaaaaaagcggcggtcattggcggcggcttgcttggcttggaggcggcg
cgcggcctgcttcacttaggaatggatgtcgatgtcatccatattttcgactatttgatg
gaacgccagcttgatccgaccgcttccaagctgctgcagcgggagctggagaaacaaggg
atgaacgttttgcttcgcaaggagacggccgaattgttcggcaacggccgtgtggaggga
gtgcggtttaaggacggtacgtccattgccgccgacttggtggtgatggcggtcggcatt
cgtccgaatgttgatttagcgcggagaagcggcattgaagtgaatcgagggatcgttgtc
aatgactacttggaaacgagcgtgccgcacatttacgcggtcggtgaatgcgcggaacat
cgcggtgttgtgtatggactcgtcgctccgctttatgagcaggggaaagtgctggcacaa
gcgatttgcggccgaaaaggaaagccgtatgaaggatctgtcgttgcgactcagctgaaa
gtgtccggtgtcgacgtgttctcggctggtgaatttatggatggcgaagggacggagtcg
atcaaactgtatgacgaagcgcgctcggtgtacaagaaagtcgtcgttcgcgaagggaaa
atcgttggtgcagtgctgtttggcgatacgagcgaaggaagaaaactatttgatatgatc
cagcgcggcgattcggttgaggcgctctcgctgtcgctgtttgccccaaccgcttcaggc
gggaagggaagtcttgcggcggcgatggccgacaccgatgtggtttgcggttgcaacggg
gtgacaaaaggcgcgatttgtcaggcgattgccgaacacgggctcaagacggtcgccgag
gtgcgcgactatacgaatgcgtcccgctcgtgcggcggatgcaaagggcttgtcgccgag
ctgcttgagcatatgcttggtgaagaagcgaaccggtatgcggtgaaagaaacgatctgc
ggctgcacggacctaagccgcgaggaagtggttgcagcgatcaaagaaaagcggctgatg
acggtcaaagaagtgatgagtgtattgggatggaaaaacgaggaagggtgttcgaaatgc
cgtccggcgctcaattattacctgggcatgttgtatccgggcgagtacgatgaagaagcg
gaatcgttgtttgtcaatgagcggctgcacgccaacatccaggccgacggcacgtactcc
gttgtcccgcgcatatatggcggggtgacgacagccgaacagctgcggaacatcgctgat
gtcgcggaaaaatacaacgtgccgatgattaagatcaccggcgggcagcgcattgacttg
cttggggtgaaaaaagaagatttgccgcgcatttgggccgatctcggcatgccgtccggc
tacgcctacgccaaggcgcttcggacggtgaaaacgtgcgtcggcaagcagttttgccgc
tttgggacgcaagattcgaccgggcttggcattcggatggaacaaacatttgagcggctg
aaaacgccgcataaagtgaaaatggccgtctccgcctgcccgcgcaactgtgcggaatcg
ggcattaaagatgtcggcgtcgtcggcgtcgagggcggatgggagatttatgtcggcggc
aacggcggcacccatttgcgtgcagctgacttgctttgcacggtcaagacggaagacgaa
gtgatcgagatgaccggtgcttttttgcaatattaccgcgagtccgcgcattatttggaa
cggacgtccaaatgggtcgagcgcgtcgggcttgagcatatccgcgaagtgttgttcgat
gtggaaacgcgccgcgcgctgcttgagcggcttcataaagctctttcggcgacaaaagat
ccgtggcgggaaatcgtcgaaaacgatgaactgcaacaaacattgttccgcgatatcggc
gacaaagagccggtgccggtggaatga

DBGET integrated database retrieval system