Geobacillus lituanicus: GLN3_05535 Help Entry GLN3_05535        CDS       T05193                                  Name (GenBank) sporulation protein   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism gli  Geobacillus lituanicus Brite KEGG Orthology (KO) [BR:gli00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     GLN3_05535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  ASS86630 LinkDB All DBs Position 1096294..1096434 Genome browser AA seq 46 aa AA seqDB search MKHLSDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHKIKLSS NT seq 141 nt NT seq  +upstreamnt  +downstreamnt atgaaacatttatcggatgaactgttgatcgagtcgtacttcaaggcgaaagaactcaac ttaagcccggaattcatcgaattgatcgaaaaggaaatccagcgccgctcattgacccat aaaatcaagctgtcgtcgtga

DBGET integrated database retrieval system