KEGG   Geobacillus lituanicus: GLN3_06205Help
Entry
GLN3_06205        CDS       T05193                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
gli  Geobacillus lituanicus
Pathway
gli00020  Citrate cycle (TCA cycle)
gli00190  Oxidative phosphorylation
gli00650  Butanoate metabolism
gli01100  Metabolic pathways
gli01110  Biosynthesis of secondary metabolites
gli01120  Microbial metabolism in diverse environments
gli01130  Biosynthesis of antibiotics
gli01200  Carbon metabolism
Module
gli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLN3_06205
   00650 Butanoate metabolism
    GLN3_06205
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GLN3_06205
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GLN3_06205
    1.3.5.4  fumarate reductase (quinol)
     GLN3_06205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_18 Fer4_4 Fer4_13 Fer4_21 Fer4_15 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ASS86753
UniProt: A0A223DUX2
LinkDB All DBs
Position
complement(1235285..1236046)
Genome map
AA seq 253 aa AA seqDB search
MSENKTVRFIITRQDRPDSAPYEEEFVIPYRPNMNVISALMEIRRNPVNAKGEKTTPVAW
EMNCLEEVCGACSMVINGKPRQACAALIDKLEQPIRLEPMRTFPVIRDLVIDRSRMFDAL
KRVKAWIPIDGTYDLGPGPRMPERKRQWAYELSKCMTCGVCLEACPNVNSKSNFIGPAPL
SQVRLFNAHPTGAMHKAERLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRETT
IQMFRDFFGSDEV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacaaaacggttcggttcatcatcacgcgccaagatcgtccggattccgct
ccatatgaagaggagtttgtcattccgtaccgcccgaacatgaacgtcatttcggcgctc
atggaaattcgccgcaatccggtcaacgccaaaggggaaaaaacgacgccggtcgcctgg
gaaatgaactgtttggaagaagtgtgcggggcctgctcgatggtcattaacggaaagccg
cggcaagcatgtgcggcgctcattgataaattagagcagccgatccgcctggagccgatg
cgcacgttcccggtcatccgcgacttggtcatcgaccggagccggatgtttgatgcgcta
aaacgcgtcaaagcatggattccaatcgacggaacgtacgacttgggtccgggtccgcgc
atgccagagcggaagcggcaatgggcgtacgagctgtcaaaatgcatgacgtgcggggtc
tgtcttgaagcgtgcccgaacgtcaacagcaagtcgaactttatcggcccggcgccgctg
tcgcaggtacggctgtttaacgcccacccgaccggggcgatgcataaagccgaacggctg
cgggcgattatgggcgatggcggactggccaactgtggcaactcgcaaaactgcgtgcaa
tcgtgcccgaaaggcattccgttgacgacatcgatcgcggcgttaaaccgcgaaacgacg
attcaaatgttccgcgatttctttggaagcgacgaagtgtaa

DBGET integrated database retrieval system