KEGG   Geobacillus lituanicus: GLN3_06210Help
Entry
GLN3_06210        CDS       T05193                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
gli  Geobacillus lituanicus
Pathway
gli00020  Citrate cycle (TCA cycle)
gli00190  Oxidative phosphorylation
gli00650  Butanoate metabolism
gli01100  Metabolic pathways
gli01110  Biosynthesis of secondary metabolites
gli01120  Microbial metabolism in diverse environments
gli01130  Biosynthesis of antibiotics
gli01200  Carbon metabolism
Module
gli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLN3_06210
   00650 Butanoate metabolism
    GLN3_06210
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GLN3_06210
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GLN3_06210
    1.3.5.4  fumarate reductase (quinol)
     GLN3_06210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like NAD_binding_8 FAD_binding_3 AlaDh_PNT_C FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ASS86754
UniProt: A0A223DUU3
LinkDB All DBs
Position
complement(1236048..1237805)
Genome map
AA seq 585 aa AA seqDB search
MKKGKIIVVGGGLAGLMATIKIAEAGVPVELFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIYMLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQILYALDEQVRRHEVAGLVTKYEHWEFLGIVLDDEQICRGIVAQDLR
SMEIKAFPADAVILATGGPGIIFGKSTNSVINTGSAASIAYQQGVYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIAAREIFHVCVDLK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGEDPRKVPMKVFPAVHYSMGGLWV
DYDQMTNIKGLFAAGECDYSIHGANRLGANSLLSAIYGGMVAGPNAVRYIRGLEKSADAM
PSTLYDRYVKQEQEKWENILAMDGTENAYVLHKELGEWMTANVTIVRYNDRLLKTDEKIQ
ELMERYKNISVTDTSRWSNQGATFIRQLYNMLQLARVITLGAYHRNESRGAHYKPEFPER
NDEEWLKTTMARYTPDGPAFHYEDVDVSLIKPRKRDYSKKKEEVK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggaaaaatcatcgttgtcggcggcgggttggccggcttgatggccacgatt
aaaatcgccgaagcaggagtgcctgttgagttgttttcgctcgttccggtaaagcgttct
cactccgtctgtgcccaaggcggcattaacggagcggtcaacacgaaaggggaaggcgat
tcgccgtgggaacactttgacgataccgtctacggcggcgacttcttggcgaaccagcct
ccggtcaaagcgatgtgtgaggcggcgccagggatcatttacatgctcgaccggatgggc
gtcatgttcaaccgcacgccggaagggcttcttgatttccgccgtttcggcgggacgcag
caccaccgcacggcgtacgccggggcgacgaccggacagcaaattttgtatgcgcttgac
gaacaagtgcgccgccatgaagtagcggggcttgtgacgaaatatgagcattgggaattt
ttagggatcgttttggatgacgaacaaatttgccgcggcattgtcgcgcaagacttgcgt
tcgatggaaatcaaagcgtttccagccgatgccgtcattttggcgaccggcggcccgggg
atcatttttgggaaatcgacgaactcggtcatcaacactggttcagcggcttcgatcgcc
tatcagcaaggcgtttactacgcgaacggcgagtttatccaaatccatccgaccgcgatt
ccaggcgatgacaagcttcggttgatgagcgaatcggcgcgcggggaaggcggccgcgtc
tggacgtataaagatggaaaaccatggtatttccttgaggaaaaatatccggcttacgga
aacttggtgccgcgcgatatcgccgcccgggaaattttccatgtgtgcgtcgacttgaag
ctcggcatcaacggcgaaaacatggtgtacctcgatctttcccataaagatccgaaagag
ctcgatatcaagctcggcggcattatcgaaatttatgagaagttcatgggcgaagaccca
cgcaaagtgccgatgaaagtatttccggccgttcactattcgatgggcggcttatgggtc
gactatgaccaaatgacgaacatcaaagggttgtttgccgccggtgagtgcgattattcc
attcatggcgccaaccgtctcggggcaaactcgcttctgtcggcgatttacggtggaatg
gtcgccggcccgaatgcagtccgctacatccgcggcctcgagaaatcggccgatgcgatg
ccgtcgacgctgtacgaccgttatgtcaaacaagagcaggaaaaatgggaaaacattttg
gcgatggacggcacggaaaacgcctacgtgctgcataaagagctcggtgaatggatgacg
gcaaacgtgacgatcgtccgctacaacgaccggctgctgaagaccgatgagaaaattcaa
gagctgatggagcggtataaaaacatcagcgtcaccgatacgtcgagatggagcaaccaa
ggggcgacgtttatccgccagctgtacaacatgctccagcttgcccgcgtcattacgctc
ggcgcgtaccatcgcaacgaaagccgcggggcgcactacaagccggagtttccggagcgc
aatgacgaagaatggctgaaaacgacgatggcccgctatacgccagacggtccggcgttc
cattacgaagatgtcgatgtctcgttgattaagccgcgcaaacgcgactacagcaaaaag
aaagaggaagtgaagtaa

DBGET integrated database retrieval system