KEGG   Geobacillus lituanicus: GLN3_06505Help
Entry
GLN3_06505        CDS       T05193                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gli  Geobacillus lituanicus
Pathway
gli00020  Citrate cycle (TCA cycle)
gli00480  Glutathione metabolism
gli01100  Metabolic pathways
gli01110  Biosynthesis of secondary metabolites
gli01120  Microbial metabolism in diverse environments
gli01130  Biosynthesis of antibiotics
gli01200  Carbon metabolism
gli01210  2-Oxocarboxylic acid metabolism
gli01230  Biosynthesis of amino acids
Module
gli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gli_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLN3_06505
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GLN3_06505
Enzymes [BR:gli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GLN3_06505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASS86807
UniProt: A0A223DV02
LinkDB All DBs
Position
complement(1297350..1298621)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFPGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAQYDRIVEAEGKEAANKAMAEAEAAGKIIVKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIQAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggggaaaaaattactgtcaccaatggtgtgctcaatgttccaaacaatccg
atcattccgttcattgaaggggatggaaccggcccggacatttgggcggccgcttcgcgc
gtgctggaagcagcggtggaaaaagcgtacaagggcgagaaaaaaatcgtttggaaggaa
gtgctcgccggcgaaaaagcgtacaagctgacgggcagctggcttccggatgaaacgctt
gagacgatccgcgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgttcgctcaacgtcgcgctccgccaagagctcgacctgtttgtctgcctgcgt
ccggtccgctactttcctggcgttccgtcgccggtcaaacgtccggaagacaccgatatg
gtcattttccgcgagaacacggaagacatttacgccggcattgaatacgccaaaggaacg
ccggaagtgaaaaaagtgatcgacttcttgcaaaacgaaatgggcgtgcgcaaaatccgt
ttcccggaaacgtccggcatcggcattaagccgatttccgaacaagggacgaaacggctt
gtgcgcgcggcgatcaactatgcgatcgaacacggccgcaagtcggtgacgctcgtccat
aaagggaacattatgaagttcacggaaggcgcgtttaaaaactggggctatgagcttgcc
gaacaagaattcggcgataaagtgttcacgtgggcgcaatacgatcggatcgtcgaagcc
gagggcaaagaggcggcgaacaaagcgatggcggaagcggaagcagccggcaaaatcatc
gtcaaagacgttatcgccgacatcttcctgcagcaaattttgacgcgtccgcgcgaattt
gacgtcattgcgacgatgaacttaaacggcgactacatttccgatgcgctcgcagcccaa
gtcggcggcatcggcatcgcgccgggggcgaacatcaactatgaaaccggccacgccatt
ttcgaggcgacgcacggcacggcgccgaaatacgccggtcttgacaaagtcaatccgtcg
tccgtcattttgtccggcgtcatgatgtttgagcatctcggctggaacgaagcggcgaag
ctcatcatccaggcgatggaaaaaacgattgccgccaaaatcgtcacgtacgactttgcc
cgcctgatggaaggggcaaccgaagtgaaatgttcggaatttgccgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system